Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/VapC-VagC
Location 318318..318946 Replicon chromosome
Accession NZ_CP099601
Organism Pseudomonas siliginis strain OTU6MONEA1

Toxin (Protein)


Gene name vapC Uniprot ID -
Locus tag NF679_RS01400 Protein ID WP_150637947.1
Coordinates 318318..318716 (-) Length 133 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID V8RDT4
Locus tag NF679_RS01405 Protein ID WP_024011210.1
Coordinates 318716..318946 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NF679_RS01380 (NF679_01380) 313992..314687 - 696 WP_016772144.1 ABC transporter permease -
NF679_RS01385 (NF679_01385) 314765..315517 - 753 WP_095181077.1 ABC transporter substrate-binding protein -
NF679_RS01390 (NF679_01390) 315531..316304 - 774 WP_236168220.1 ABC transporter ATP-binding protein -
NF679_RS01395 (NF679_01395) 316848..318239 + 1392 WP_150637946.1 GABA permease -
NF679_RS01400 (NF679_01400) 318318..318716 - 399 WP_150637947.1 tRNA(fMet)-specific endonuclease VapC Toxin
NF679_RS01405 (NF679_01405) 318716..318946 - 231 WP_024011210.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
NF679_RS01410 (NF679_01410) 319111..319563 - 453 WP_150741762.1 hypothetical protein -
NF679_RS01415 (NF679_01415) 319570..319983 - 414 WP_150637948.1 hypothetical protein -
NF679_RS01420 (NF679_01420) 320013..320954 - 942 WP_252868626.1 alpha/beta fold hydrolase -
NF679_RS01425 (NF679_01425) 320987..321271 + 285 WP_133337418.1 hypothetical protein -
NF679_RS01430 (NF679_01430) 321289..321579 + 291 WP_252868627.1 YceK/YidQ family lipoprotein -
NF679_RS01435 (NF679_01435) 321592..321939 - 348 WP_252868628.1 hypothetical protein -
NF679_RS01440 (NF679_01440) 321962..323440 - 1479 WP_095181072.1 PLP-dependent aminotransferase family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 310206..318946 8740


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(4-124)

Antitoxin

SpoVT-AbrB domain

(7-52)


Sequences

Toxin        


Download         Length: 133 a.a.        Molecular weight: 14548.91 Da        Isoelectric Point: 6.4602

>T249222 WP_150637947.1 NZ_CP099601:c318716-318318 [Pseudomonas siliginis]
MIKYMLDTNICIFTIKNKPQIVREAFNRHSGQLCISAITLMELIYGAEKSAAPEKNLAIVEGFVARLDVLPFDNDAAAQA
GMVRSELAKAGTPIGPYDQMIAGHARSLGLIVVTNNVREFERVSGLRIEDWV

Download         Length: 399 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8588.62 Da        Isoelectric Point: 4.5203

>AT249222 WP_024011210.1 NZ_CP099601:c318946-318716 [Pseudomonas siliginis]
MEQTTIFMSNRSQAVRLPKAVAMPGDVKRVEVIAIGRTRVITPAGESWDSWFDGDSVSPDFMANREQPTEQERESF

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB V8RDT4

References