Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-YafN |
| Location | 173927..174443 | Replicon | chromosome |
| Accession | NZ_CP099601 | ||
| Organism | Pseudomonas siliginis strain OTU6MONEA1 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | NF679_RS00740 | Protein ID | WP_071174010.1 |
| Coordinates | 174162..174443 (+) | Length | 94 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | A0A2U1R4X8 |
| Locus tag | NF679_RS00735 | Protein ID | WP_041477418.1 |
| Coordinates | 173927..174172 (+) | Length | 82 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NF679_RS00715 (NF679_00715) | 169288..170826 | + | 1539 | WP_252868576.1 | MFS transporter | - |
| NF679_RS00720 (NF679_00720) | 170854..171921 | + | 1068 | WP_150637840.1 | HlyD family secretion protein | - |
| NF679_RS00725 (NF679_00725) | 171918..173513 | + | 1596 | WP_252868577.1 | efflux transporter outer membrane subunit | - |
| NF679_RS00730 (NF679_00730) | 173592..173837 | + | 246 | WP_252868578.1 | DUF2789 domain-containing protein | - |
| NF679_RS00735 (NF679_00735) | 173927..174172 | + | 246 | WP_041477418.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| NF679_RS00740 (NF679_00740) | 174162..174443 | + | 282 | WP_071174010.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NF679_RS00745 (NF679_00745) | 174805..175233 | + | 429 | WP_016772266.1 | winged helix DNA-binding protein | - |
| NF679_RS00750 (NF679_00750) | 175230..177293 | + | 2064 | WP_252868579.1 | FUSC family protein | - |
| NF679_RS00755 (NF679_00755) | 177290..177499 | + | 210 | WP_016772264.1 | DUF1656 domain-containing protein | - |
| NF679_RS00760 (NF679_00760) | 177496..178383 | + | 888 | WP_252868580.1 | HlyD family secretion protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10842.73 Da Isoelectric Point: 10.5812
>T249221 WP_071174010.1 NZ_CP099601:174162-174443 [Pseudomonas siliginis]
MTYKLEFLPSAHKEWNKLGHTLREQFKKKLGERLKLPRIPADALHSMPDCYKIKLKASGYRLVYQVIDERVVVSVLAVGK
RERSSVYDAARNR
MTYKLEFLPSAHKEWNKLGHTLREQFKKKLGERLKLPRIPADALHSMPDCYKIKLKASGYRLVYQVIDERVVVSVLAVGK
RERSSVYDAARNR
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|