Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 1739315..1739931 | Replicon | chromosome |
| Accession | NZ_CP099600 | ||
| Organism | Pseudomonas siliginis strain OTU6MEDAA1 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | - |
| Locus tag | NF678_RS07535 | Protein ID | WP_076566640.1 |
| Coordinates | 1739315..1739527 (+) | Length | 71 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | V8RA99 |
| Locus tag | NF678_RS07540 | Protein ID | WP_016771035.1 |
| Coordinates | 1739527..1739931 (+) | Length | 135 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NF678_RS07505 (NF678_07505) | 1735416..1735952 | + | 537 | WP_024012128.1 | DsbE family thiol:disulfide interchange protein | - |
| NF678_RS07510 (NF678_07510) | 1735949..1736419 | + | 471 | WP_252883387.1 | cytochrome c-type biogenesis protein CcmH | - |
| NF678_RS07515 (NF678_07515) | 1736416..1737615 | + | 1200 | WP_150741296.1 | c-type cytochrome biogenesis protein CcmI | - |
| NF678_RS07520 (NF678_07520) | 1737641..1738045 | + | 405 | WP_016771039.1 | hypothetical protein | - |
| NF678_RS07525 (NF678_07525) | 1738092..1738668 | - | 577 | Protein_1485 | PIN domain-containing protein | - |
| NF678_RS07530 (NF678_07530) | 1738665..1739132 | - | 468 | WP_252883388.1 | helix-turn-helix domain-containing protein | - |
| NF678_RS07535 (NF678_07535) | 1739315..1739527 | + | 213 | WP_076566640.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| NF678_RS07540 (NF678_07540) | 1739527..1739931 | + | 405 | WP_016771035.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| NF678_RS07545 (NF678_07545) | 1740044..1741243 | - | 1200 | WP_252879662.1 | MFS transporter | - |
| NF678_RS07550 (NF678_07550) | 1741411..1742409 | - | 999 | WP_056783861.1 | sulfate ABC transporter substrate-binding protein | - |
| NF678_RS07555 (NF678_07555) | 1742514..1743338 | - | 825 | WP_064365449.1 | ion transporter | - |
| NF678_RS07560 (NF678_07560) | 1743360..1744274 | - | 915 | WP_252883389.1 | urea transporter | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 71 a.a. Molecular weight: 7934.09 Da Isoelectric Point: 10.8102
>T249217 WP_076566640.1 NZ_CP099600:1739315-1739527 [Pseudomonas siliginis]
VQSRLLMKELEEAGWTLDRVAGSHHIFTHRYNPNTIAVPHPKKDLPLGTVKSIRRRAGLFSPPTRHEGDP
VQSRLLMKELEEAGWTLDRVAGSHHIFTHRYNPNTIAVPHPKKDLPLGTVKSIRRRAGLFSPPTRHEGDP
Download Length: 213 bp
Antitoxin
Download Length: 135 a.a. Molecular weight: 14776.81 Da Isoelectric Point: 4.5789
>AT249217 WP_016771035.1 NZ_CP099600:1739527-1739931 [Pseudomonas siliginis]
MQYPICIEWGDENTAIGIQIPDIPGAVTAGDSFEEAYNAAVEVAHLMLQEIAAAGQAIPMPTSAAAHRNHPDFAEMGWGM
LELDISPYLGKTEKVNVTLPGYVIQRIDRYVREHNVKSRSSFLADAAMEKLVRY
MQYPICIEWGDENTAIGIQIPDIPGAVTAGDSFEEAYNAAVEVAHLMLQEIAAAGQAIPMPTSAAAHRNHPDFAEMGWGM
LELDISPYLGKTEKVNVTLPGYVIQRIDRYVREHNVKSRSSFLADAAMEKLVRY
Download Length: 405 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|