Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-YafN |
Location | 176591..177107 | Replicon | chromosome |
Accession | NZ_CP099600 | ||
Organism | Pseudomonas siliginis strain OTU6MEDAA1 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | NF678_RS00730 | Protein ID | WP_252882968.1 |
Coordinates | 176826..177107 (+) | Length | 94 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A2U1R4X8 |
Locus tag | NF678_RS00725 | Protein ID | WP_041477418.1 |
Coordinates | 176591..176836 (+) | Length | 82 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NF678_RS00705 (NF678_00705) | 171952..173490 | + | 1539 | WP_252882966.1 | MFS transporter | - |
NF678_RS00710 (NF678_00710) | 173518..174585 | + | 1068 | WP_150637840.1 | HlyD family secretion protein | - |
NF678_RS00715 (NF678_00715) | 174582..176177 | + | 1596 | WP_252882967.1 | efflux transporter outer membrane subunit | - |
NF678_RS00720 (NF678_00720) | 176256..176501 | + | 246 | WP_150742984.1 | DUF2789 domain-containing protein | - |
NF678_RS00725 (NF678_00725) | 176591..176836 | + | 246 | WP_041477418.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
NF678_RS00730 (NF678_00730) | 176826..177107 | + | 282 | WP_252882968.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NF678_RS00735 (NF678_00735) | 177471..177899 | + | 429 | WP_016772266.1 | winged helix DNA-binding protein | - |
NF678_RS00740 (NF678_00740) | 177896..179959 | + | 2064 | WP_150742985.1 | FUSC family protein | - |
NF678_RS00745 (NF678_00745) | 179956..180165 | + | 210 | WP_016772264.1 | DUF1656 domain-containing protein | - |
NF678_RS00750 (NF678_00750) | 180162..181049 | + | 888 | WP_056786955.1 | HlyD family secretion protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10839.73 Da Isoelectric Point: 10.5812
>T249215 WP_252882968.1 NZ_CP099600:176826-177107 [Pseudomonas siliginis]
MTYKLEFLPSAHKEWNKLGHTLREQFKKKLGERLKLPRIPADALHGMPDCYKIKLKASGYRLVYQVIDERVVVSVLAVGK
RERNSVYDAARNR
MTYKLEFLPSAHKEWNKLGHTLREQFKKKLGERLKLPRIPADALHGMPDCYKIKLKASGYRLVYQVIDERVVVSVLAVGK
RERNSVYDAARNR
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|