Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/RelE(toxin) |
Location | 2284278..2284758 | Replicon | chromosome |
Accession | NZ_CP099599 | ||
Organism | Pseudomonas siliginis strain OTU6ESPEB1 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | NF677_RS10095 | Protein ID | WP_252885723.1 |
Coordinates | 2284278..2284562 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | NF677_RS10100 | Protein ID | WP_123463680.1 |
Coordinates | 2284552..2284758 (-) | Length | 69 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NF677_RS10060 (NF677_10060) | 2280154..2280627 | + | 474 | WP_252885722.1 | type II secretion system protein | - |
NF677_RS10065 (NF677_10065) | 2280633..2281007 | + | 375 | WP_122610261.1 | type II secretion system protein | - |
NF677_RS10070 (NF677_10070) | 2280982..2281521 | + | 540 | WP_150741547.1 | type II secretion system protein | - |
NF677_RS10075 (NF677_10075) | 2281518..2281910 | + | 393 | WP_038364891.1 | curli production assembly/transport protein CsgE | - |
NF677_RS10080 (NF677_10080) | 2281907..2282338 | + | 432 | WP_122610259.1 | curli assembly protein CsgF | - |
NF677_RS10085 (NF677_10085) | 2282368..2283228 | + | 861 | WP_150741549.1 | CsgG/HfaB family protein | - |
NF677_RS10090 (NF677_10090) | 2283734..2284104 | + | 371 | Protein_1982 | DUF6124 family protein | - |
NF677_RS10095 (NF677_10095) | 2284278..2284562 | - | 285 | WP_252885723.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NF677_RS10100 (NF677_10100) | 2284552..2284758 | - | 207 | WP_123463680.1 | antitoxin | Antitoxin |
NF677_RS10105 (NF677_10105) | 2285035..2286486 | - | 1452 | WP_252885724.1 | curlin | - |
NF677_RS10110 (NF677_10110) | 2286514..2286978 | - | 465 | WP_150741552.1 | curlin | - |
NF677_RS10115 (NF677_10115) | 2287050..2289278 | - | 2229 | WP_150741553.1 | Ig-like domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10851.68 Da Isoelectric Point: 10.5014
>T249210 WP_252885723.1 NZ_CP099599:c2284562-2284278 [Pseudomonas siliginis]
MQIKWRPKARVELSKILKYIGERNFEAATALHKSVVKATSALCWLPHLYRKGRSPGTREIVVSPNYLVVYQVADHIEIVS
ILHARQEYPRRDPG
MQIKWRPKARVELSKILKYIGERNFEAATALHKSVVKATSALCWLPHLYRKGRSPGTREIVVSPNYLVVYQVADHIEIVS
ILHARQEYPRRDPG
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|