Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 1761217..1761833 | Replicon | chromosome |
| Accession | NZ_CP099599 | ||
| Organism | Pseudomonas siliginis strain OTU6ESPEB1 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | - |
| Locus tag | NF677_RS07760 | Protein ID | WP_041479616.1 |
| Coordinates | 1761217..1761429 (+) | Length | 71 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | V8RA99 |
| Locus tag | NF677_RS07765 | Protein ID | WP_016771035.1 |
| Coordinates | 1761429..1761833 (+) | Length | 135 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NF677_RS07730 (NF677_07730) | 1757320..1757856 | + | 537 | WP_024012128.1 | DsbE family thiol:disulfide interchange protein | - |
| NF677_RS07735 (NF677_07735) | 1757853..1758323 | + | 471 | WP_252883387.1 | cytochrome c-type biogenesis protein CcmH | - |
| NF677_RS07740 (NF677_07740) | 1758320..1759519 | + | 1200 | WP_252885574.1 | c-type cytochrome biogenesis protein CcmI | - |
| NF677_RS07745 (NF677_07745) | 1759545..1759949 | + | 405 | WP_016771039.1 | hypothetical protein | - |
| NF677_RS07750 (NF677_07750) | 1759997..1760571 | - | 575 | Protein_1529 | PIN domain-containing protein | - |
| NF677_RS07755 (NF677_07755) | 1760568..1761035 | - | 468 | WP_252885575.1 | helix-turn-helix domain-containing protein | - |
| NF677_RS07760 (NF677_07760) | 1761217..1761429 | + | 213 | WP_041479616.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| NF677_RS07765 (NF677_07765) | 1761429..1761833 | + | 405 | WP_016771035.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| NF677_RS07770 (NF677_07770) | 1761946..1763145 | - | 1200 | WP_252885576.1 | MFS transporter | - |
| NF677_RS07775 (NF677_07775) | 1763313..1764311 | - | 999 | WP_056783861.1 | sulfate ABC transporter substrate-binding protein | - |
| NF677_RS07780 (NF677_07780) | 1764415..1765239 | - | 825 | WP_041479613.1 | ion transporter | - |
| NF677_RS07785 (NF677_07785) | 1765261..1766175 | - | 915 | WP_252885577.1 | urea transporter | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 71 a.a. Molecular weight: 7960.12 Da Isoelectric Point: 10.5523
>T249209 WP_041479616.1 NZ_CP099599:1761217-1761429 [Pseudomonas siliginis]
VQSRLLMKELEEAGWTLDRVAGSHYIFTHRYNPNTIAVPHPKKDLPLGTVKSIRRRAGLFSPPTRHEGDP
VQSRLLMKELEEAGWTLDRVAGSHYIFTHRYNPNTIAVPHPKKDLPLGTVKSIRRRAGLFSPPTRHEGDP
Download Length: 213 bp
Antitoxin
Download Length: 135 a.a. Molecular weight: 14776.81 Da Isoelectric Point: 4.5789
>AT249209 WP_016771035.1 NZ_CP099599:1761429-1761833 [Pseudomonas siliginis]
MQYPICIEWGDENTAIGIQIPDIPGAVTAGDSFEEAYNAAVEVAHLMLQEIAAAGQAIPMPTSAAAHRNHPDFAEMGWGM
LELDISPYLGKTEKVNVTLPGYVIQRIDRYVREHNVKSRSSFLADAAMEKLVRY
MQYPICIEWGDENTAIGIQIPDIPGAVTAGDSFEEAYNAAVEVAHLMLQEIAAAGQAIPMPTSAAAHRNHPDFAEMGWGM
LELDISPYLGKTEKVNVTLPGYVIQRIDRYVREHNVKSRSSFLADAAMEKLVRY
Download Length: 405 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|