Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-YafN |
Location | 174713..175229 | Replicon | chromosome |
Accession | NZ_CP099599 | ||
Organism | Pseudomonas siliginis strain OTU6ESPEB1 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | NF677_RS00730 | Protein ID | WP_252877214.1 |
Coordinates | 174948..175229 (+) | Length | 94 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A2U1R4X8 |
Locus tag | NF677_RS00725 | Protein ID | WP_041477418.1 |
Coordinates | 174713..174958 (+) | Length | 82 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NF677_RS00705 (NF677_00705) | 170074..171612 | + | 1539 | WP_252885114.1 | MFS transporter | - |
NF677_RS00710 (NF677_00710) | 171640..172707 | + | 1068 | WP_150637840.1 | HlyD family secretion protein | - |
NF677_RS00715 (NF677_00715) | 172704..174299 | + | 1596 | WP_252885115.1 | efflux transporter outer membrane subunit | - |
NF677_RS00720 (NF677_00720) | 174378..174623 | + | 246 | WP_252885116.1 | DUF2789 domain-containing protein | - |
NF677_RS00725 (NF677_00725) | 174713..174958 | + | 246 | WP_041477418.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
NF677_RS00730 (NF677_00730) | 174948..175229 | + | 282 | WP_252877214.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NF677_RS00735 (NF677_00735) | 175591..176019 | + | 429 | WP_150743122.1 | winged helix DNA-binding protein | - |
NF677_RS00740 (NF677_00740) | 176016..178079 | + | 2064 | WP_150742985.1 | FUSC family protein | - |
NF677_RS00745 (NF677_00745) | 178076..178285 | + | 210 | WP_016772264.1 | DUF1656 domain-containing protein | - |
NF677_RS00750 (NF677_00750) | 178282..179169 | + | 888 | WP_016772263.1 | HlyD family secretion protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10812.70 Da Isoelectric Point: 10.5812
>T249208 WP_252877214.1 NZ_CP099599:174948-175229 [Pseudomonas siliginis]
MTYKLEFLPSAHKEWNKLGHTLREQFKKKLGERLKLPRIPADALHGMPDCYKIKLKASGYRLVYQVIDERVVVSVLAVGK
RERSSVYDAARNR
MTYKLEFLPSAHKEWNKLGHTLREQFKKKLGERLKLPRIPADALHGMPDCYKIKLKASGYRLVYQVIDERVVVSVLAVGK
RERSSVYDAARNR
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|