Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 1747326..1747942 | Replicon | chromosome |
| Accession | NZ_CP099598 | ||
| Organism | Pseudomonas siliginis strain OTU6BANIB1 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | - |
| Locus tag | NF676_RS08295 | Protein ID | WP_041479616.1 |
| Coordinates | 1747326..1747538 (+) | Length | 71 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | V8RA99 |
| Locus tag | NF676_RS08300 | Protein ID | WP_016771035.1 |
| Coordinates | 1747538..1747942 (+) | Length | 135 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NF676_RS08265 (NF676_08265) | 1743428..1743964 | + | 537 | WP_024012128.1 | DsbE family thiol:disulfide interchange protein | - |
| NF676_RS08270 (NF676_08270) | 1743961..1744431 | + | 471 | WP_252869016.1 | cytochrome c-type biogenesis protein CcmH | - |
| NF676_RS08275 (NF676_08275) | 1744428..1745627 | + | 1200 | WP_252887514.1 | c-type cytochrome biogenesis protein CcmI | - |
| NF676_RS08280 (NF676_08280) | 1745653..1746057 | + | 405 | WP_016771039.1 | hypothetical protein | - |
| NF676_RS08285 (NF676_08285) | 1746103..1746678 | - | 576 | Protein_1518 | PIN domain-containing protein | - |
| NF676_RS08290 (NF676_08290) | 1746675..1747142 | - | 468 | WP_252887515.1 | helix-turn-helix domain-containing protein | - |
| NF676_RS08295 (NF676_08295) | 1747326..1747538 | + | 213 | WP_041479616.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| NF676_RS08300 (NF676_08300) | 1747538..1747942 | + | 405 | WP_016771035.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| NF676_RS08305 (NF676_08305) | 1748056..1749255 | - | 1200 | WP_252887516.1 | MFS transporter | - |
| NF676_RS08310 (NF676_08310) | 1749423..1750421 | - | 999 | WP_136492212.1 | sulfate ABC transporter substrate-binding protein | - |
| NF676_RS08315 (NF676_08315) | 1750525..1751349 | - | 825 | WP_041479613.1 | ion transporter | - |
| NF676_RS08320 (NF676_08320) | 1751371..1752285 | - | 915 | WP_252887517.1 | urea transporter | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 71 a.a. Molecular weight: 7960.12 Da Isoelectric Point: 10.5523
>T249203 WP_041479616.1 NZ_CP099598:1747326-1747538 [Pseudomonas siliginis]
VQSRLLMKELEEAGWTLDRVAGSHYIFTHRYNPNTIAVPHPKKDLPLGTVKSIRRRAGLFSPPTRHEGDP
VQSRLLMKELEEAGWTLDRVAGSHYIFTHRYNPNTIAVPHPKKDLPLGTVKSIRRRAGLFSPPTRHEGDP
Download Length: 213 bp
Antitoxin
Download Length: 135 a.a. Molecular weight: 14776.81 Da Isoelectric Point: 4.5789
>AT249203 WP_016771035.1 NZ_CP099598:1747538-1747942 [Pseudomonas siliginis]
MQYPICIEWGDENTAIGIQIPDIPGAVTAGDSFEEAYNAAVEVAHLMLQEIAAAGQAIPMPTSAAAHRNHPDFAEMGWGM
LELDISPYLGKTEKVNVTLPGYVIQRIDRYVREHNVKSRSSFLADAAMEKLVRY
MQYPICIEWGDENTAIGIQIPDIPGAVTAGDSFEEAYNAAVEVAHLMLQEIAAAGQAIPMPTSAAAHRNHPDFAEMGWGM
LELDISPYLGKTEKVNVTLPGYVIQRIDRYVREHNVKSRSSFLADAAMEKLVRY
Download Length: 405 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|