Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09812-MazE |
Location | 511313..511944 | Replicon | chromosome |
Accession | NZ_CP099598 | ||
Organism | Pseudomonas siliginis strain OTU6BANIB1 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | - |
Locus tag | NF676_RS02885 | Protein ID | WP_056787412.1 |
Coordinates | 511582..511944 (+) | Length | 121 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | J2YH56 |
Locus tag | NF676_RS02880 | Protein ID | WP_008077592.1 |
Coordinates | 511313..511582 (+) | Length | 90 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NF676_RS02845 (NF676_02845) | 506812..507357 | - | 546 | WP_041477595.1 | membrane protein | - |
NF676_RS02850 (NF676_02850) | 507354..507608 | - | 255 | WP_016772026.1 | acyl carrier protein | - |
NF676_RS02855 (NF676_02855) | 507618..507893 | - | 276 | WP_039756723.1 | phosphopantetheine-binding protein | - |
NF676_RS02860 (NF676_02860) | 507871..508683 | - | 813 | WP_041477597.1 | lysophospholipid acyltransferase family protein | - |
NF676_RS02865 (NF676_02865) | 508659..509384 | - | 726 | WP_041477598.1 | beta-ketoacyl synthase chain length factor | - |
NF676_RS02870 (NF676_02870) | 509741..510511 | + | 771 | WP_056787407.1 | ParA family protein | - |
NF676_RS02875 (NF676_02875) | 510642..511076 | - | 435 | WP_056787410.1 | thioredoxin TrxC | - |
NF676_RS02880 (NF676_02880) | 511313..511582 | + | 270 | WP_008077592.1 | hypothetical protein | Antitoxin |
NF676_RS02885 (NF676_02885) | 511582..511944 | + | 363 | WP_056787412.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
NF676_RS02890 (NF676_02890) | 511950..513413 | - | 1464 | WP_252887201.1 | YdiU family protein | - |
NF676_RS02895 (NF676_02895) | 513462..516815 | - | 3354 | WP_252887202.1 | mechanosensitive channel MscK | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 13386.31 Da Isoelectric Point: 7.1665
>T249202 WP_056787412.1 NZ_CP099598:511582-511944 [Pseudomonas siliginis]
MVRRQPPQRGDVYWIDPNPVAGREMMNRHRFVVITPREINALGVSMTVPVTSGGNFSRYMGLAVAITGHETNGVAVCNQV
RSFDIEQRVRDGTAKFIERLDDVTMSDIVDRVISAIDPLS
MVRRQPPQRGDVYWIDPNPVAGREMMNRHRFVVITPREINALGVSMTVPVTSGGNFSRYMGLAVAITGHETNGVAVCNQV
RSFDIEQRVRDGTAKFIERLDDVTMSDIVDRVISAIDPLS
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|