Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 358401..359029 | Replicon | chromosome |
| Accession | NZ_CP099598 | ||
| Organism | Pseudomonas siliginis strain OTU6BANIB1 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | NF676_RS02210 | Protein ID | WP_016772140.1 |
| Coordinates | 358401..358799 (-) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | V8RDT4 |
| Locus tag | NF676_RS02215 | Protein ID | WP_024011210.1 |
| Coordinates | 358799..359029 (-) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NF676_RS02190 (NF676_02190) | 354075..354770 | - | 696 | WP_041477511.1 | ABC transporter permease | - |
| NF676_RS02195 (NF676_02195) | 354848..355600 | - | 753 | WP_150741763.1 | ABC transporter substrate-binding protein | - |
| NF676_RS02200 (NF676_02200) | 355614..356387 | - | 774 | WP_236168220.1 | ABC transporter ATP-binding protein | - |
| NF676_RS02205 (NF676_02205) | 356931..358322 | + | 1392 | WP_016772141.1 | GABA permease | - |
| NF676_RS02210 (NF676_02210) | 358401..358799 | - | 399 | WP_016772140.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
| NF676_RS02215 (NF676_02215) | 358799..359029 | - | 231 | WP_024011210.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| NF676_RS02220 (NF676_02220) | 359195..359647 | - | 453 | WP_056787197.1 | hypothetical protein | - |
| NF676_RS02225 (NF676_02225) | 359654..360067 | - | 414 | WP_236168218.1 | hypothetical protein | - |
| NF676_RS02230 (NF676_02230) | 360097..360999 | - | 903 | WP_252887942.1 | alpha/beta fold hydrolase | - |
| NF676_RS02235 (NF676_02235) | 361139..362197 | - | 1059 | WP_095181074.1 | PDDEXK nuclease domain-containing protein | - |
| NF676_RS02240 (NF676_02240) | 362477..362821 | - | 345 | WP_056787206.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14547.92 Da Isoelectric Point: 7.1340
>T249201 WP_016772140.1 NZ_CP099598:c358799-358401 [Pseudomonas siliginis]
MIKYMLDTNICIFTIKNKPQIVREAFNRHSGQLCISAITLMELIYGAEKSAAPEKNLAIVEGFVARLDVLPFDNDAAAQA
GMVRSELAKAGTPIGPYDQMIAGHARSLGLIVVTNNVREFQRVSGLRIEDWV
MIKYMLDTNICIFTIKNKPQIVREAFNRHSGQLCISAITLMELIYGAEKSAAPEKNLAIVEGFVARLDVLPFDNDAAAQA
GMVRSELAKAGTPIGPYDQMIAGHARSLGLIVVTNNVREFQRVSGLRIEDWV
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|