Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-YafN |
| Location | 174285..174801 | Replicon | chromosome |
| Accession | NZ_CP099598 | ||
| Organism | Pseudomonas siliginis strain OTU6BANIB1 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | NF676_RS01320 | Protein ID | WP_071174010.1 |
| Coordinates | 174520..174801 (+) | Length | 94 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | A0A2U1R4X8 |
| Locus tag | NF676_RS01315 | Protein ID | WP_041477418.1 |
| Coordinates | 174285..174530 (+) | Length | 82 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NF676_RS01295 (NF676_01295) | 169646..171184 | + | 1539 | WP_252887098.1 | MFS transporter | - |
| NF676_RS01300 (NF676_01300) | 171212..172279 | + | 1068 | WP_252887099.1 | HlyD family secretion protein | - |
| NF676_RS01305 (NF676_01305) | 172276..173871 | + | 1596 | WP_252887100.1 | efflux transporter outer membrane subunit | - |
| NF676_RS01310 (NF676_01310) | 173950..174195 | + | 246 | WP_252887101.1 | DUF2789 domain-containing protein | - |
| NF676_RS01315 (NF676_01315) | 174285..174530 | + | 246 | WP_041477418.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| NF676_RS01320 (NF676_01320) | 174520..174801 | + | 282 | WP_071174010.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NF676_RS01325 (NF676_01325) | 175165..175593 | + | 429 | WP_016772266.1 | winged helix DNA-binding protein | - |
| NF676_RS01330 (NF676_01330) | 175590..177653 | + | 2064 | WP_252887102.1 | FUSC family protein | - |
| NF676_RS01335 (NF676_01335) | 177650..177859 | + | 210 | WP_016772264.1 | DUF1656 domain-containing protein | - |
| NF676_RS01340 (NF676_01340) | 177856..178743 | + | 888 | WP_056786955.1 | HlyD family secretion protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10842.73 Da Isoelectric Point: 10.5812
>T249200 WP_071174010.1 NZ_CP099598:174520-174801 [Pseudomonas siliginis]
MTYKLEFLPSAHKEWNKLGHTLREQFKKKLGERLKLPRIPADALHSMPDCYKIKLKASGYRLVYQVIDERVVVSVLAVGK
RERSSVYDAARNR
MTYKLEFLPSAHKEWNKLGHTLREQFKKKLGERLKLPRIPADALHSMPDCYKIKLKASGYRLVYQVIDERVVVSVLAVGK
RERSSVYDAARNR
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|