Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 20027..20661 | Replicon | plasmid unnamed1 |
| Accession | NZ_CP099597 | ||
| Organism | Pseudomonas siliginis strain OTU6BANIB1 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | - |
| Locus tag | NF676_RS00130 | Protein ID | WP_016359316.1 |
| Coordinates | 20479..20661 (-) | Length | 61 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | NF676_RS00125 | Protein ID | WP_252886142.1 |
| Coordinates | 20027..20449 (-) | Length | 141 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NF676_RS00070 (NF676_00070) | 15087..15395 | - | 309 | WP_252886131.1 | plasmid mobilization protein MobA | - |
| NF676_RS00075 (NF676_00075) | 15635..16120 | + | 486 | WP_252886132.1 | hypothetical protein | - |
| NF676_RS00080 (NF676_00080) | 16110..16814 | + | 705 | WP_252886133.1 | protein mobD | - |
| NF676_RS00085 (NF676_00085) | 16807..17454 | + | 648 | WP_252886134.1 | hypothetical protein | - |
| NF676_RS00090 (NF676_00090) | 17617..17778 | + | 162 | WP_252886135.1 | hypothetical protein | - |
| NF676_RS00095 (NF676_00095) | 17828..18073 | - | 246 | WP_252886136.1 | hypothetical protein | - |
| NF676_RS00100 (NF676_00100) | 18092..18313 | - | 222 | WP_252886137.1 | hypothetical protein | - |
| NF676_RS00105 (NF676_00105) | 18330..18605 | - | 276 | WP_252886138.1 | hypothetical protein | - |
| NF676_RS00110 (NF676_00110) | 18634..18855 | - | 222 | WP_252886139.1 | hypothetical protein | - |
| NF676_RS00115 (NF676_00115) | 18867..19307 | - | 441 | WP_252886140.1 | hypothetical protein | - |
| NF676_RS00120 (NF676_00120) | 19323..20006 | - | 684 | WP_252886141.1 | hypothetical protein | - |
| NF676_RS00125 (NF676_00125) | 20027..20449 | - | 423 | WP_252886142.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| NF676_RS00130 (NF676_00130) | 20479..20661 | - | 183 | WP_016359316.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| NF676_RS00135 (NF676_00135) | 21089..21367 | + | 279 | WP_252886143.1 | hypothetical protein | - |
| NF676_RS00140 (NF676_00140) | 21374..22327 | - | 954 | WP_252886144.1 | non-homologous end-joining DNA ligase | - |
| NF676_RS00145 (NF676_00145) | 22603..23088 | - | 486 | WP_252886145.1 | hypothetical protein | - |
| NF676_RS00150 (NF676_00150) | 23170..23403 | - | 234 | WP_252886146.1 | hypothetical protein | - |
| NF676_RS00155 (NF676_00155) | 23421..23777 | - | 357 | WP_252886147.1 | hypothetical protein | - |
| NF676_RS00160 (NF676_00160) | 23797..24516 | - | 720 | WP_252886148.1 | hypothetical protein | - |
| NF676_RS00165 (NF676_00165) | 24622..24819 | - | 198 | WP_252886149.1 | hypothetical protein | - |
| NF676_RS00170 (NF676_00170) | 24835..25071 | - | 237 | WP_252886150.1 | hypothetical protein | - |
| NF676_RS00175 (NF676_00175) | 25204..25341 | - | 138 | WP_252886151.1 | hypothetical protein | - |
| NF676_RS00180 (NF676_00180) | 25356..25538 | - | 183 | WP_252886152.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..103148 | 103148 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6882.04 Da Isoelectric Point: 10.5498
>T249199 WP_016359316.1 NZ_CP099597:c20661-20479 [Pseudomonas siliginis]
MKCSEFRRWLLAQGVEFKSAKGSHFKVYLNGKSTIFADHGSKEMHEGLRKTIIKQLGLKD
MKCSEFRRWLLAQGVEFKSAKGSHFKVYLNGKSTIFADHGSKEMHEGLRKTIIKQLGLKD
Download Length: 183 bp
Antitoxin
Download Length: 141 a.a. Molecular weight: 15420.86 Da Isoelectric Point: 4.9533
>AT249199 WP_252886142.1 NZ_CP099597:c20449-20027 [Pseudomonas siliginis]
MYQYPLEVHREPTGVWLSCPDIPEMNAAGDTLADAFAEALNGMESALSLYVEQRRKIPAASAPSDPALVLHLPALTVAKI
MLWNAMLEEDVSRAELARRLGCSRQVVDRLVDFIHASKIEQVERALGLLGRRLSLVLEAA
MYQYPLEVHREPTGVWLSCPDIPEMNAAGDTLADAFAEALNGMESALSLYVEQRRKIPAASAPSDPALVLHLPALTVAKI
MLWNAMLEEDVSRAELARRLGCSRQVVDRLVDFIHASKIEQVERALGLLGRRLSLVLEAA
Download Length: 423 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|