Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/RelE(toxin) |
| Location | 2317084..2317564 | Replicon | chromosome |
| Accession | NZ_CP099596 | ||
| Organism | Pseudomonas siliginis strain OTU6BAGNBB1 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | NF675_RS10150 | Protein ID | WP_252879826.1 |
| Coordinates | 2317084..2317368 (-) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | NF675_RS10155 | Protein ID | WP_123463680.1 |
| Coordinates | 2317358..2317564 (-) | Length | 69 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NF675_RS10115 (NF675_10115) | 2312943..2313416 | + | 474 | WP_122700552.1 | type II secretion system protein | - |
| NF675_RS10120 (NF675_10120) | 2313422..2313796 | + | 375 | WP_122610261.1 | type II secretion system protein | - |
| NF675_RS10125 (NF675_10125) | 2313771..2314310 | + | 540 | WP_150741547.1 | type II secretion system protein | - |
| NF675_RS10130 (NF675_10130) | 2314307..2314699 | + | 393 | WP_038364891.1 | curli production assembly/transport protein CsgE | - |
| NF675_RS10135 (NF675_10135) | 2314696..2315127 | + | 432 | WP_122610259.1 | curli assembly protein CsgF | - |
| NF675_RS10140 (NF675_10140) | 2315157..2316017 | + | 861 | WP_150741549.1 | CsgG/HfaB family protein | - |
| NF675_RS10145 (NF675_10145) | 2316539..2316910 | + | 372 | WP_150741550.1 | DUF6124 family protein | - |
| NF675_RS10150 (NF675_10150) | 2317084..2317368 | - | 285 | WP_252879826.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NF675_RS10155 (NF675_10155) | 2317358..2317564 | - | 207 | WP_123463680.1 | antitoxin | Antitoxin |
| NF675_RS10160 (NF675_10160) | 2317841..2319292 | - | 1452 | WP_252879827.1 | curlin | - |
| NF675_RS10165 (NF675_10165) | 2319320..2319784 | - | 465 | WP_150741552.1 | curlin | - |
| NF675_RS10170 (NF675_10170) | 2319856..2322084 | - | 2229 | WP_252879828.1 | Ig-like domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10875.66 Da Isoelectric Point: 10.5014
>T249196 WP_252879826.1 NZ_CP099596:c2317368-2317084 [Pseudomonas siliginis]
MQIKWRPKARVELSKILKYIGERNFEAATALHKSVVKATSALCWHPHLYRKGRSPGTREIVVSPNYLVVYQVADHIEIVS
ILHARQEYPRRDPG
MQIKWRPKARVELSKILKYIGERNFEAATALHKSVVKATSALCWHPHLYRKGRSPGTREIVVSPNYLVVYQVADHIEIVS
ILHARQEYPRRDPG
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|