Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 1766739..1767355 | Replicon | chromosome |
| Accession | NZ_CP099596 | ||
| Organism | Pseudomonas siliginis strain OTU6BAGNBB1 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | - |
| Locus tag | NF675_RS07665 | Protein ID | WP_076566640.1 |
| Coordinates | 1766739..1766951 (+) | Length | 71 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | V8RA99 |
| Locus tag | NF675_RS07670 | Protein ID | WP_016771035.1 |
| Coordinates | 1766951..1767355 (+) | Length | 135 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NF675_RS07635 (NF675_07635) | 1762840..1763376 | + | 537 | WP_024012128.1 | DsbE family thiol:disulfide interchange protein | - |
| NF675_RS07640 (NF675_07640) | 1763373..1763843 | + | 471 | WP_252879660.1 | cytochrome c-type biogenesis protein CcmH | - |
| NF675_RS07645 (NF675_07645) | 1763840..1765039 | + | 1200 | WP_252879661.1 | c-type cytochrome biogenesis protein CcmI | - |
| NF675_RS07650 (NF675_07650) | 1765065..1765469 | + | 405 | WP_073472737.1 | hypothetical protein | - |
| NF675_RS07655 (NF675_07655) | 1765516..1766091 | - | 576 | Protein_1511 | PIN domain-containing protein | - |
| NF675_RS07660 (NF675_07660) | 1766088..1766555 | - | 468 | WP_095180734.1 | helix-turn-helix domain-containing protein | - |
| NF675_RS07665 (NF675_07665) | 1766739..1766951 | + | 213 | WP_076566640.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| NF675_RS07670 (NF675_07670) | 1766951..1767355 | + | 405 | WP_016771035.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| NF675_RS07675 (NF675_07675) | 1767468..1768667 | - | 1200 | WP_252879662.1 | MFS transporter | - |
| NF675_RS07680 (NF675_07680) | 1768835..1769833 | - | 999 | WP_136492212.1 | sulfate ABC transporter substrate-binding protein | - |
| NF675_RS07685 (NF675_07685) | 1769938..1770762 | - | 825 | WP_064365449.1 | ion transporter | - |
| NF675_RS07690 (NF675_07690) | 1770784..1771698 | - | 915 | WP_252879663.1 | urea transporter | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 71 a.a. Molecular weight: 7934.09 Da Isoelectric Point: 10.8102
>T249195 WP_076566640.1 NZ_CP099596:1766739-1766951 [Pseudomonas siliginis]
VQSRLLMKELEEAGWTLDRVAGSHHIFTHRYNPNTIAVPHPKKDLPLGTVKSIRRRAGLFSPPTRHEGDP
VQSRLLMKELEEAGWTLDRVAGSHHIFTHRYNPNTIAVPHPKKDLPLGTVKSIRRRAGLFSPPTRHEGDP
Download Length: 213 bp
Antitoxin
Download Length: 135 a.a. Molecular weight: 14776.81 Da Isoelectric Point: 4.5789
>AT249195 WP_016771035.1 NZ_CP099596:1766951-1767355 [Pseudomonas siliginis]
MQYPICIEWGDENTAIGIQIPDIPGAVTAGDSFEEAYNAAVEVAHLMLQEIAAAGQAIPMPTSAAAHRNHPDFAEMGWGM
LELDISPYLGKTEKVNVTLPGYVIQRIDRYVREHNVKSRSSFLADAAMEKLVRY
MQYPICIEWGDENTAIGIQIPDIPGAVTAGDSFEEAYNAAVEVAHLMLQEIAAAGQAIPMPTSAAAHRNHPDFAEMGWGM
LELDISPYLGKTEKVNVTLPGYVIQRIDRYVREHNVKSRSSFLADAAMEKLVRY
Download Length: 405 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|