Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-YafN |
| Location | 177789..178305 | Replicon | chromosome |
| Accession | NZ_CP099596 | ||
| Organism | Pseudomonas siliginis strain OTU6BAGNBB1 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | NF675_RS00730 | Protein ID | WP_071174010.1 |
| Coordinates | 178024..178305 (+) | Length | 94 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | A0A2U1R4X8 |
| Locus tag | NF675_RS00725 | Protein ID | WP_041477418.1 |
| Coordinates | 177789..178034 (+) | Length | 82 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NF675_RS00705 (NF675_00705) | 173150..174688 | + | 1539 | WP_252879203.1 | MFS transporter | - |
| NF675_RS00710 (NF675_00710) | 174716..175783 | + | 1068 | WP_252879204.1 | HlyD family secretion protein | - |
| NF675_RS00715 (NF675_00715) | 175924..177375 | + | 1452 | WP_252880128.1 | efflux transporter outer membrane subunit | - |
| NF675_RS00720 (NF675_00720) | 177454..177699 | + | 246 | WP_252879205.1 | DUF2789 domain-containing protein | - |
| NF675_RS00725 (NF675_00725) | 177789..178034 | + | 246 | WP_041477418.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| NF675_RS00730 (NF675_00730) | 178024..178305 | + | 282 | WP_071174010.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NF675_RS00735 (NF675_00735) | 178669..179097 | + | 429 | WP_150743122.1 | winged helix DNA-binding protein | - |
| NF675_RS00740 (NF675_00740) | 179094..181157 | + | 2064 | WP_150742985.1 | FUSC family protein | - |
| NF675_RS00745 (NF675_00745) | 181154..181363 | + | 210 | WP_016772264.1 | DUF1656 domain-containing protein | - |
| NF675_RS00750 (NF675_00750) | 181360..182247 | + | 888 | WP_056786955.1 | HlyD family secretion protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10842.73 Da Isoelectric Point: 10.5812
>T249193 WP_071174010.1 NZ_CP099596:178024-178305 [Pseudomonas siliginis]
MTYKLEFLPSAHKEWNKLGHTLREQFKKKLGERLKLPRIPADALHSMPDCYKIKLKASGYRLVYQVIDERVVVSVLAVGK
RERSSVYDAARNR
MTYKLEFLPSAHKEWNKLGHTLREQFKKKLGERLKLPRIPADALHSMPDCYKIKLKASGYRLVYQVIDERVVVSVLAVGK
RERSSVYDAARNR
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|