Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 57085..57710 | Replicon | plasmid unnamed |
| Accession | NZ_CP099591 | ||
| Organism | Escherichia coli strain WG1 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | NHF37_RS23070 | Protein ID | WP_000911324.1 |
| Coordinates | 57085..57483 (-) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | L4J1D2 |
| Locus tag | NHF37_RS23075 | Protein ID | WP_000450532.1 |
| Coordinates | 57483..57710 (-) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NHF37_RS23055 (53393) | 53393..53914 | + | 522 | WP_000632670.1 | conjugal transfer entry exclusion protein TraS | - |
| NHF37_RS23060 (53939) | 53939..54670 | + | 732 | WP_000850422.1 | conjugal transfer complement resistance protein TraT | - |
| NHF37_RS23065 (54923) | 54923..57076 | + | 2154 | WP_000009350.1 | type IV conjugative transfer system coupling protein TraD | - |
| NHF37_RS23070 (57085) | 57085..57483 | - | 399 | WP_000911324.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| NHF37_RS23075 (57483) | 57483..57710 | - | 228 | WP_000450532.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | - | 1..67408 | 67408 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14800.09 Da Isoelectric Point: 7.8604
>T249192 WP_000911324.1 NZ_CP099591:c57483-57085 [Escherichia coli]
MLKFMLDTNICIFTIKNKPASVRERFNLNQGRMCISSVTLMEVIYGAEKSQMPERNLAVIEGFVSRIDVLDYDAAAATHT
GQIRAELALQGRPVGPFDQMIAGHARSRGLIIVTNNTREFERVGGLRIEDWS
MLKFMLDTNICIFTIKNKPASVRERFNLNQGRMCISSVTLMEVIYGAEKSQMPERNLAVIEGFVSRIDVLDYDAAAATHT
GQIRAELALQGRPVGPFDQMIAGHARSRGLIIVTNNTREFERVGGLRIEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|