Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
Location | 11460..11985 | Replicon | plasmid unnamed |
Accession | NZ_CP099591 | ||
Organism | Escherichia coli strain WG1 |
Toxin (Protein)
Gene name | ccdB | Uniprot ID | V0SSI5 |
Locus tag | NHF37_RS22780 | Protein ID | WP_001159868.1 |
Coordinates | 11680..11985 (+) | Length | 102 a.a. |
Antitoxin (Protein)
Gene name | ccdA | Uniprot ID | S1PPD8 |
Locus tag | NHF37_RS22775 | Protein ID | WP_000813634.1 |
Coordinates | 11460..11678 (+) | Length | 73 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NHF37_RS22760 (6616) | 6616..7515 | + | 900 | WP_000963206.1 | nucleotide-binding protein | - |
NHF37_RS22765 (7565) | 7565..9790 | - | 2226 | WP_000698737.1 | P-loop NTPase fold protein | - |
NHF37_RS22770 (9792) | 9792..10880 | - | 1089 | WP_000952217.1 | transcriptional repressor PifC | - |
NHF37_RS22775 (11460) | 11460..11678 | + | 219 | WP_000813634.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
NHF37_RS22780 (11680) | 11680..11985 | + | 306 | WP_001159868.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
NHF37_RS22785 (11986) | 11986..12792 | + | 807 | WP_000016982.1 | site-specific integrase | - |
NHF37_RS22790 (13566) | 13566..14321 | + | 756 | WP_000852146.1 | replication initiation protein RepE | - |
NHF37_RS22795 (14909) | 14909..16075 | + | 1167 | WP_000772446.1 | plasmid-partitioning protein SopA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | - | - | 1..67408 | 67408 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11706.51 Da Isoelectric Point: 6.4674
>T249188 WP_001159868.1 NZ_CP099591:11680-11985 [Escherichia coli]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|