Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | yjhX-yjhQ/YjhX-GNAT |
| Location | 4018950..4019764 | Replicon | chromosome |
| Accession | NZ_CP099590 | ||
| Organism | Escherichia coli strain WG1 | ||
Toxin (Protein)
| Gene name | yjhX | Uniprot ID | S1PA82 |
| Locus tag | NHF37_RS19645 | Protein ID | WP_001054376.1 |
| Coordinates | 4018950..4019207 (+) | Length | 86 a.a. |
Antitoxin (Protein)
| Gene name | yjhQ | Uniprot ID | U9Z4B8 |
| Locus tag | NHF37_RS19650 | Protein ID | WP_001309181.1 |
| Coordinates | 4019219..4019764 (+) | Length | 182 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NHF37_RS19620 (4014238) | 4014238..4015344 | + | 1107 | WP_001309184.1 | N-acetylneuraminate epimerase | - |
| NHF37_RS19625 (4015409) | 4015409..4016389 | + | 981 | WP_000991438.1 | 9-O-acetyl-N-acetylneuraminic acid deacetylase | - |
| NHF37_RS19630 (4016499) | 4016499..4016704 | + | 206 | Protein_3861 | HNH endonuclease | - |
| NHF37_RS19635 (4016972) | 4016972..4018212 | - | 1241 | Protein_3862 | helicase YjhR | - |
| NHF37_RS19640 (4018328) | 4018328..4018459 | + | 132 | WP_001309182.1 | hypothetical protein | - |
| NHF37_RS19645 (4018950) | 4018950..4019207 | + | 258 | WP_001054376.1 | YjhX family toxin | Toxin |
| NHF37_RS19650 (4019219) | 4019219..4019764 | + | 546 | WP_001309181.1 | N-acetyltransferase | Antitoxin |
| NHF37_RS19655 (4019820) | 4019820..4020566 | + | 747 | WP_000354251.1 | class I SAM-dependent methyltransferase | - |
| NHF37_RS19660 (4020735) | 4020735..4020953 | + | 219 | Protein_3867 | hypothetical protein | - |
| NHF37_RS19665 (4020991) | 4020991..4021107 | + | 117 | Protein_3868 | VOC family protein | - |
| NHF37_RS19670 (4021352) | 4021352..4022473 | + | 1122 | WP_000010829.1 | M42 family metallopeptidase | - |
| NHF37_RS19675 (4022470) | 4022470..4022748 | + | 279 | WP_000722973.1 | PTS sugar transporter subunit IIB SgcB | - |
| NHF37_RS19680 (4022760) | 4022760..4024073 | + | 1314 | WP_000460843.1 | PTS sugar transporter subunit IIC SgcC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | fimB | 4011444..4027988 | 16544 | |
| - | inside | Genomic island | - | fimI / fimA / fimE / fimB | 4008737..4027988 | 19251 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 86 a.a. Molecular weight: 9734.29 Da Isoelectric Point: 11.0090
>T249185 WP_001054376.1 NZ_CP099590:4018950-4019207 [Escherichia coli]
MNLSRQEQHTLHVLAKGRRIAHVRDSSGRVTSVECYSREGLLLTDCTLAVFKKLKTKKLIKSVNGQPYRINTTELNKVRA
QLDNR
MNLSRQEQHTLHVLAKGRRIAHVRDSSGRVTSVECYSREGLLLTDCTLAVFKKLKTKKLIKSVNGQPYRINTTELNKVRA
QLDNR
Download Length: 258 bp
Antitoxin
Download Length: 182 a.a. Molecular weight: 19956.90 Da Isoelectric Point: 6.3277
>AT249185 WP_001309181.1 NZ_CP099590:4019219-4019764 [Escherichia coli]
MTVHHFTFHITDKSDASDIREVETRAFGFSKEADLVASLLEDESARPALSLLARYEGKAVGHILFTRATFKGEMDSPLMH
ILAPLAVIPEYQGMGVGGRLIRTGIEHLRLMGCQTVFVLGHATYYPRHGFEPCAGDKGYPAPYPIPEEHKACWMMQSLTA
QPMTLTGHIRCADPDETGALT
MTVHHFTFHITDKSDASDIREVETRAFGFSKEADLVASLLEDESARPALSLLARYEGKAVGHILFTRATFKGEMDSPLMH
ILAPLAVIPEYQGMGVGGRLIRTGIEHLRLMGCQTVFVLGHATYYPRHGFEPCAGDKGYPAPYPIPEEHKACWMMQSLTA
QPMTLTGHIRCADPDETGALT
Download Length: 546 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|