Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3442891..3443509 | Replicon | chromosome |
| Accession | NZ_CP099590 | ||
| Organism | Escherichia coli strain WG1 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | H5UYE2 |
| Locus tag | NHF37_RS16855 | Protein ID | WP_001291435.1 |
| Coordinates | 3443291..3443509 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | S1PTH5 |
| Locus tag | NHF37_RS16850 | Protein ID | WP_000344800.1 |
| Coordinates | 3442891..3443265 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NHF37_RS16840 (3437980) | 3437980..3439173 | + | 1194 | WP_001295324.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| NHF37_RS16845 (3439196) | 3439196..3442345 | + | 3150 | WP_001132469.1 | efflux RND transporter permease AcrB | - |
| NHF37_RS16850 (3442891) | 3442891..3443265 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
| NHF37_RS16855 (3443291) | 3443291..3443509 | + | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
| NHF37_RS16860 (3443681) | 3443681..3444232 | + | 552 | WP_000102564.1 | maltose O-acetyltransferase | - |
| NHF37_RS16865 (3444348) | 3444348..3444818 | + | 471 | WP_000136192.1 | YlaC family protein | - |
| NHF37_RS16870 (3444982) | 3444982..3446532 | + | 1551 | WP_001310610.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
| NHF37_RS16875 (3446574) | 3446574..3446927 | - | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
| NHF37_RS16885 (3447306) | 3447306..3447617 | + | 312 | WP_000409911.1 | MGMT family protein | - |
| NHF37_RS16890 (3447648) | 3447648..3448220 | - | 573 | WP_000779842.1 | YbaY family lipoprotein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T249179 WP_001291435.1 NZ_CP099590:3443291-3443509 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT249179 WP_000344800.1 NZ_CP099590:3442891-3443265 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| PDB | 2MW2 | |
| PDB | 1JW2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9QBQ5 |