Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
Location | 2368879..2369517 | Replicon | chromosome |
Accession | NZ_CP099590 | ||
Organism | Escherichia coli strain WG1 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | S1F9G9 |
Locus tag | NHF37_RS11470 | Protein ID | WP_000813794.1 |
Coordinates | 2369341..2369517 (-) | Length | 59 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | NHF37_RS11465 | Protein ID | WP_001270286.1 |
Coordinates | 2368879..2369295 (-) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NHF37_RS11445 (2364031) | 2364031..2364972 | - | 942 | WP_001251304.1 | ABC transporter permease | - |
NHF37_RS11450 (2364973) | 2364973..2365986 | - | 1014 | WP_000220396.1 | ABC transporter ATP-binding protein | - |
NHF37_RS11455 (2366004) | 2366004..2367149 | - | 1146 | WP_000047424.1 | ABC transporter substrate-binding protein | - |
NHF37_RS11460 (2367394) | 2367394..2368800 | - | 1407 | WP_000760626.1 | PLP-dependent aminotransferase family protein | - |
NHF37_RS11465 (2368879) | 2368879..2369295 | - | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
NHF37_RS11470 (2369341) | 2369341..2369517 | - | 177 | WP_000813794.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
NHF37_RS11475 (2369739) | 2369739..2369969 | + | 231 | WP_000494244.1 | YncJ family protein | - |
NHF37_RS11480 (2370061) | 2370061..2372022 | - | 1962 | WP_001303492.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
NHF37_RS11485 (2372095) | 2372095..2372631 | - | 537 | WP_000429155.1 | DNA-binding transcriptional regulator SutR | - |
NHF37_RS11490 (2372723) | 2372723..2373898 | + | 1176 | WP_001236265.1 | BenE family transporter YdcO | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6749.83 Da Isoelectric Point: 11.2298
>T249178 WP_000813794.1 NZ_CP099590:c2369517-2369341 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT249178 WP_001270286.1 NZ_CP099590:c2369295-2368879 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|