Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 1793115..1793946 | Replicon | chromosome |
| Accession | NZ_CP099590 | ||
| Organism | Escherichia coli strain WG1 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | S1P968 |
| Locus tag | NHF37_RS08545 | Protein ID | WP_000854814.1 |
| Coordinates | 1793115..1793489 (-) | Length | 125 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | P76364 |
| Locus tag | NHF37_RS08550 | Protein ID | WP_001285584.1 |
| Coordinates | 1793578..1793946 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NHF37_RS08505 (1788511) | 1788511..1789677 | + | 1167 | WP_000830156.1 | serine-type D-Ala-D-Ala carboxypeptidase DacD | - |
| NHF37_RS08510 (1789796) | 1789796..1790269 | + | 474 | WP_001105415.1 | DNA gyrase inhibitor SbmC | - |
| NHF37_RS08515 (1790467) | 1790467..1791525 | + | 1059 | WP_001200891.1 | FUSC family protein | - |
| NHF37_RS08520 (1791697) | 1791697..1792026 | + | 330 | WP_000450409.1 | DUF496 family protein | - |
| NHF37_RS08525 (1792127) | 1792127..1792261 | - | 135 | WP_001297944.1 | EutP/PduV family microcompartment system protein | - |
| NHF37_RS08530 (1792381) | 1792381..1792509 | + | 129 | Protein_1678 | transposase domain-containing protein | - |
| NHF37_RS08535 (1792798) | 1792798..1792878 | - | 81 | Protein_1679 | hypothetical protein | - |
| NHF37_RS08540 (1792924) | 1792924..1793118 | - | 195 | WP_000988600.1 | DUF5983 family protein | - |
| NHF37_RS08545 (1793115) | 1793115..1793489 | - | 375 | WP_000854814.1 | type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA | Toxin |
| NHF37_RS08550 (1793578) | 1793578..1793946 | - | 369 | WP_001285584.1 | type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA | Antitoxin |
| NHF37_RS08555 (1794020) | 1794020..1794241 | - | 222 | WP_000692323.1 | DUF987 domain-containing protein | - |
| NHF37_RS08560 (1794304) | 1794304..1794750 | - | 447 | WP_000187523.1 | RadC family protein | - |
| NHF37_RS08565 (1794747) | 1794747..1796279 | - | 1533 | WP_001350525.1 | protein YeeR | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 13898.94 Da Isoelectric Point: 7.8522
>T249171 WP_000854814.1 NZ_CP099590:c1793489-1793115 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK
Download Length: 375 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13651.52 Da Isoelectric Point: 5.9541
>AT249171 WP_001285584.1 NZ_CP099590:c1793946-1793578 [Escherichia coli]
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCDYVYLAVYPTPEMKN
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCDYVYLAVYPTPEMKN
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829FY50 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 2H28 | |
| AlphaFold DB | A0A1M2E8G6 |