Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | yjhX-yjhQ/YjhX-GNAT |
| Location | 4024075..4024889 | Replicon | chromosome |
| Accession | NZ_CP099588 | ||
| Organism | Escherichia coli strain EMG2 | ||
Toxin (Protein)
| Gene name | yjhX | Uniprot ID | S1PA82 |
| Locus tag | NHF38_RS19665 | Protein ID | WP_001054376.1 |
| Coordinates | 4024075..4024332 (+) | Length | 86 a.a. |
Antitoxin (Protein)
| Gene name | yjhQ | Uniprot ID | U9Z4B8 |
| Locus tag | NHF38_RS19670 | Protein ID | WP_001309181.1 |
| Coordinates | 4024344..4024889 (+) | Length | 182 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NHF38_RS19640 (4019363) | 4019363..4020469 | + | 1107 | WP_001309184.1 | N-acetylneuraminate epimerase | - |
| NHF38_RS19645 (4020534) | 4020534..4021514 | + | 981 | WP_000991438.1 | 9-O-acetyl-N-acetylneuraminic acid deacetylase | - |
| NHF38_RS19650 (4021624) | 4021624..4021829 | + | 206 | Protein_3865 | HNH endonuclease | - |
| NHF38_RS19655 (4022097) | 4022097..4023337 | - | 1241 | Protein_3866 | helicase YjhR | - |
| NHF38_RS19660 (4023453) | 4023453..4023584 | + | 132 | WP_001309182.1 | hypothetical protein | - |
| NHF38_RS19665 (4024075) | 4024075..4024332 | + | 258 | WP_001054376.1 | YjhX family toxin | Toxin |
| NHF38_RS19670 (4024344) | 4024344..4024889 | + | 546 | WP_001309181.1 | N-acetyltransferase | Antitoxin |
| NHF38_RS19675 (4024945) | 4024945..4025691 | + | 747 | WP_000354251.1 | class I SAM-dependent methyltransferase | - |
| NHF38_RS19680 (4025860) | 4025860..4026078 | + | 219 | Protein_3871 | hypothetical protein | - |
| NHF38_RS19685 (4026116) | 4026116..4026232 | + | 117 | Protein_3872 | VOC family protein | - |
| NHF38_RS19690 (4026477) | 4026477..4027598 | + | 1122 | WP_000010829.1 | M42 family metallopeptidase | - |
| NHF38_RS19695 (4027595) | 4027595..4027873 | + | 279 | WP_000722973.1 | PTS sugar transporter subunit IIB SgcB | - |
| NHF38_RS19700 (4027885) | 4027885..4029198 | + | 1314 | WP_000460843.1 | PTS sugar transporter subunit IIC SgcC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | fimB | 4016569..4033113 | 16544 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 86 a.a. Molecular weight: 9734.29 Da Isoelectric Point: 11.0090
>T249154 WP_001054376.1 NZ_CP099588:4024075-4024332 [Escherichia coli]
MNLSRQEQHTLHVLAKGRRIAHVRDSSGRVTSVECYSREGLLLTDCTLAVFKKLKTKKLIKSVNGQPYRINTTELNKVRA
QLDNR
MNLSRQEQHTLHVLAKGRRIAHVRDSSGRVTSVECYSREGLLLTDCTLAVFKKLKTKKLIKSVNGQPYRINTTELNKVRA
QLDNR
Download Length: 258 bp
Antitoxin
Download Length: 182 a.a. Molecular weight: 19956.90 Da Isoelectric Point: 6.3277
>AT249154 WP_001309181.1 NZ_CP099588:4024344-4024889 [Escherichia coli]
MTVHHFTFHITDKSDASDIREVETRAFGFSKEADLVASLLEDESARPALSLLARYEGKAVGHILFTRATFKGEMDSPLMH
ILAPLAVIPEYQGMGVGGRLIRTGIEHLRLMGCQTVFVLGHATYYPRHGFEPCAGDKGYPAPYPIPEEHKACWMMQSLTA
QPMTLTGHIRCADPDETGALT
MTVHHFTFHITDKSDASDIREVETRAFGFSKEADLVASLLEDESARPALSLLARYEGKAVGHILFTRATFKGEMDSPLMH
ILAPLAVIPEYQGMGVGGRLIRTGIEHLRLMGCQTVFVLGHATYYPRHGFEPCAGDKGYPAPYPIPEEHKACWMMQSLTA
QPMTLTGHIRCADPDETGALT
Download Length: 546 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|