Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yafW-ykfI/CbtA-CbeA |
| Location | 3653245..3653924 | Replicon | chromosome |
| Accession | NZ_CP099588 | ||
| Organism | Escherichia coli strain EMG2 | ||
Toxin (Protein)
| Gene name | ykfI | Uniprot ID | P77692 |
| Locus tag | NHF38_RS17915 | Protein ID | WP_000854672.1 |
| Coordinates | 3653583..3653924 (+) | Length | 114 a.a. |
Antitoxin (Protein)
| Gene name | yafW | Uniprot ID | Q47684 |
| Locus tag | NHF38_RS17910 | Protein ID | WP_000070395.1 |
| Coordinates | 3653245..3653562 (+) | Length | 106 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NHF38_RS17860 (3648292) | 3648292..3649155 | + | 864 | WP_001065553.1 | GTPase family protein | - |
| NHF38_RS17865 (3649247) | 3649247..3650068 | + | 822 | WP_000197389.1 | DUF932 domain-containing protein | - |
| NHF38_RS17870 (3650285) | 3650285..3650476 | + | 192 | Protein_3518 | DeoR family transcriptional regulator | - |
| NHF38_RS17875 (3650472) | 3650472..3650699 | + | 228 | WP_001548158.1 | protein YpjK | - |
| NHF38_RS17880 (3650699) | 3650699..3651142 | + | 444 | WP_000824223.1 | lipoprotein YafY | - |
| NHF38_RS17885 (3651165) | 3651165..3651632 | + | 468 | WP_001547765.1 | protein YkfB | - |
| NHF38_RS17890 (3651709) | 3651709..3651948 | + | 240 | WP_000194654.1 | DUF905 family protein | - |
| NHF38_RS17895 (3652046) | 3652046..3652504 | + | 459 | WP_000211838.1 | antirestriction protein | - |
| NHF38_RS17900 (3652520) | 3652520..3652996 | + | 477 | WP_000811693.1 | RadC family protein | - |
| NHF38_RS17905 (3653005) | 3653005..3653226 | + | 222 | WP_000691994.1 | DUF987 domain-containing protein | - |
| NHF38_RS17910 (3653245) | 3653245..3653562 | + | 318 | WP_000070395.1 | type IV toxin-antitoxin system antitoxin YafW | Antitoxin |
| NHF38_RS17915 (3653583) | 3653583..3653924 | + | 342 | WP_000854672.1 | type IV toxin-antitoxin system toxin YkfI | Toxin |
| NHF38_RS17925 (3654496) | 3654496..3655749 | - | 1254 | WP_000893278.1 | glutamate-5-semialdehyde dehydrogenase | - |
| NHF38_RS17930 (3655761) | 3655761..3656864 | - | 1104 | WP_001285288.1 | glutamate 5-kinase | - |
| NHF38_RS17935 (3657152) | 3657152..3658207 | + | 1056 | WP_000749863.1 | phosphoporin PhoE | - |
| NHF38_RS17940 (3658246) | 3658246..3658647 | - | 402 | WP_000174689.1 | sigma factor-binding protein Crl | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12905.01 Da Isoelectric Point: 9.6543
>T249149 WP_000854672.1 NZ_CP099588:3653583-3653924 [Escherichia coli]
MKTLPAITQRAVKPCLSPVAVWQMLLTRLLEQHYGLTINDTPFCNEAVIKEHIDAGITLADAVNFLVEKYELVRIDRKGF
SWQEQSPYLRAADILRARQATGLLRQSRNNVVR
MKTLPAITQRAVKPCLSPVAVWQMLLTRLLEQHYGLTINDTPFCNEAVIKEHIDAGITLADAVNFLVEKYELVRIDRKGF
SWQEQSPYLRAADILRARQATGLLRQSRNNVVR
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|