Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapC-vagC/VapC-VagC |
| Location | 44179..44816 | Replicon | plasmid unnamed3 |
| Accession | NZ_CP099586 | ||
| Organism | Burkholderia glumae strain GR20004 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | C5AP38 |
| Locus tag | NFI99_RS13940 | Protein ID | WP_012735347.1 |
| Coordinates | 44179..44580 (-) | Length | 134 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | C5AP39 |
| Locus tag | NFI99_RS13945 | Protein ID | WP_012735348.1 |
| Coordinates | 44580..44816 (-) | Length | 79 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NFI99_RS13900 (NFI99_13890) | 39665..40585 | - | 921 | Protein_43 | IS66 family transposase | - |
| NFI99_RS13905 (NFI99_13895) | 40617..40967 | - | 351 | WP_012732753.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| NFI99_RS13910 (NFI99_13900) | 40943..41419 | - | 477 | WP_012734051.1 | transposase | - |
| NFI99_RS13915 (NFI99_13905) | 41521..41685 | + | 165 | WP_252836677.1 | hypothetical protein | - |
| NFI99_RS13920 (NFI99_13910) | 41701..41988 | + | 288 | WP_012735344.1 | hypothetical protein | - |
| NFI99_RS13925 (NFI99_13915) | 43092..43286 | - | 195 | WP_124837731.1 | hypothetical protein | - |
| NFI99_RS13930 (NFI99_13920) | 43341..43583 | - | 243 | WP_012735345.1 | hypothetical protein | - |
| NFI99_RS13935 (NFI99_13925) | 43601..44164 | - | 564 | WP_012735346.1 | hypothetical protein | - |
| NFI99_RS13940 (NFI99_13930) | 44179..44580 | - | 402 | WP_012735347.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| NFI99_RS13945 (NFI99_13935) | 44580..44816 | - | 237 | WP_012735348.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| NFI99_RS13950 (NFI99_13940) | 45153..45845 | - | 693 | WP_043308722.1 | hypothetical protein | - |
| NFI99_RS13955 (NFI99_13945) | 45929..47755 | - | 1827 | WP_012735349.1 | site-specific integrase | - |
| NFI99_RS13960 (NFI99_13950) | 47752..48132 | - | 381 | WP_080569442.1 | hypothetical protein | - |
| NFI99_RS13965 (NFI99_13955) | 48135..48452 | - | 318 | WP_050811486.1 | hypothetical protein | - |
| NFI99_RS13970 (NFI99_13960) | 48503..49591 | - | 1089 | Protein_57 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..121702 | 121702 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 134 a.a. Molecular weight: 14847.12 Da Isoelectric Point: 5.2138
>T249129 WP_012735347.1 NZ_CP099586:c44580-44179 [Burkholderia glumae]
MPRFMLDTNMCIYLMKNQPEQVAKRFAECFVGDVVMSAITYAELEYGVAVSDNRAKERRNLAALIEDILVAPFDAAAAVA
YGPIREATRERKKDHLDKLIAAHAVALDVVLVTNNAKDFASYPGIKLDNWLND
MPRFMLDTNMCIYLMKNQPEQVAKRFAECFVGDVVMSAITYAELEYGVAVSDNRAKERRNLAALIEDILVAPFDAAAAVA
YGPIREATRERKKDHLDKLIAAHAVALDVVLVTNNAKDFASYPGIKLDNWLND
Download Length: 402 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|