Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapC-vagC/VapC-VagC
Location 44179..44816 Replicon plasmid unnamed3
Accession NZ_CP099586
Organism Burkholderia glumae strain GR20004

Toxin (Protein)


Gene name vapC Uniprot ID C5AP38
Locus tag NFI99_RS13940 Protein ID WP_012735347.1
Coordinates 44179..44580 (-) Length 134 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID C5AP39
Locus tag NFI99_RS13945 Protein ID WP_012735348.1
Coordinates 44580..44816 (-) Length 79 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NFI99_RS13900 (NFI99_13890) 39665..40585 - 921 Protein_43 IS66 family transposase -
NFI99_RS13905 (NFI99_13895) 40617..40967 - 351 WP_012732753.1 IS66 family insertion sequence element accessory protein TnpB -
NFI99_RS13910 (NFI99_13900) 40943..41419 - 477 WP_012734051.1 transposase -
NFI99_RS13915 (NFI99_13905) 41521..41685 + 165 WP_252836677.1 hypothetical protein -
NFI99_RS13920 (NFI99_13910) 41701..41988 + 288 WP_012735344.1 hypothetical protein -
NFI99_RS13925 (NFI99_13915) 43092..43286 - 195 WP_124837731.1 hypothetical protein -
NFI99_RS13930 (NFI99_13920) 43341..43583 - 243 WP_012735345.1 hypothetical protein -
NFI99_RS13935 (NFI99_13925) 43601..44164 - 564 WP_012735346.1 hypothetical protein -
NFI99_RS13940 (NFI99_13930) 44179..44580 - 402 WP_012735347.1 type II toxin-antitoxin system VapC family toxin Toxin
NFI99_RS13945 (NFI99_13935) 44580..44816 - 237 WP_012735348.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
NFI99_RS13950 (NFI99_13940) 45153..45845 - 693 WP_043308722.1 hypothetical protein -
NFI99_RS13955 (NFI99_13945) 45929..47755 - 1827 WP_012735349.1 site-specific integrase -
NFI99_RS13960 (NFI99_13950) 47752..48132 - 381 WP_080569442.1 hypothetical protein -
NFI99_RS13965 (NFI99_13955) 48135..48452 - 318 WP_050811486.1 hypothetical protein -
NFI99_RS13970 (NFI99_13960) 48503..49591 - 1089 Protein_57 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..121702 121702


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-117)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 134 a.a.        Molecular weight: 14847.12 Da        Isoelectric Point: 5.2138

>T249129 WP_012735347.1 NZ_CP099586:c44580-44179 [Burkholderia glumae]
MPRFMLDTNMCIYLMKNQPEQVAKRFAECFVGDVVMSAITYAELEYGVAVSDNRAKERRNLAALIEDILVAPFDAAAAVA
YGPIREATRERKKDHLDKLIAAHAVALDVVLVTNNAKDFASYPGIKLDNWLND

Download         Length: 402 bp

Antitoxin


Download         Length: 79 a.a.        Molecular weight: 8983.13 Da        Isoelectric Point: 6.3676

>AT249129 WP_012735348.1 NZ_CP099586:c44816-44580 [Burkholderia glumae]
MQTTRVFRNGNSQAVRIPADLAYERSDVELEIERVGDEIRIRPARRPLTGVLKKFAKFSQDFMAEGRGEQEQAEREGM

Download         Length: 237 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB C5AP38

Antitoxin

Source ID Structure
AlphaFold DB C5AP39

References