Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | chpSB/PRK09812-ChpS |
Location | 7108..7703 | Replicon | plasmid unnamed1 |
Accession | NZ_CP099584 | ||
Organism | Burkholderia glumae strain GR20004 |
Toxin (Protein)
Gene name | chpB | Uniprot ID | C5AN78 |
Locus tag | NFI99_RS12200 | Protein ID | WP_012734107.1 |
Coordinates | 7353..7703 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | chpS | Uniprot ID | C5AN79 |
Locus tag | NFI99_RS12195 | Protein ID | WP_012734108.1 |
Coordinates | 7108..7359 (+) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NFI99_RS12155 (NFI99_12145) | 2156..2425 | + | 270 | WP_012732894.1 | DUF1778 domain-containing protein | - |
NFI99_RS12160 (NFI99_12150) | 2422..2910 | + | 489 | WP_012732893.1 | GNAT family N-acetyltransferase | - |
NFI99_RS12165 (NFI99_12155) | 3317..3601 | + | 285 | WP_017432347.1 | hypothetical protein | - |
NFI99_RS12170 (NFI99_12160) | 3615..3857 | + | 243 | WP_124837682.1 | hypothetical protein | - |
NFI99_RS12175 (NFI99_12165) | 3854..4099 | + | 246 | WP_127913916.1 | hypothetical protein | - |
NFI99_RS12180 (NFI99_12170) | 4156..4497 | + | 342 | WP_012732710.1 | hypothetical protein | - |
NFI99_RS12185 (NFI99_12175) | 4500..6335 | + | 1836 | WP_252836605.1 | site-specific integrase | - |
NFI99_RS12190 (NFI99_12180) | 6438..6845 | + | 408 | WP_232252319.1 | hypothetical protein | - |
NFI99_RS12195 (NFI99_12185) | 7108..7359 | + | 252 | WP_012734108.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
NFI99_RS12200 (NFI99_12190) | 7353..7703 | + | 351 | WP_012734107.1 | type II toxin-antitoxin system ChpB family toxin | Toxin |
NFI99_RS12205 (NFI99_12195) | 7762..7956 | + | 195 | WP_124837685.1 | hypothetical protein | - |
NFI99_RS12210 (NFI99_12200) | 8106..8327 | + | 222 | WP_017433768.1 | hypothetical protein | - |
NFI99_RS12215 (NFI99_12205) | 8550..9014 | + | 465 | WP_012734106.1 | Lrp/AsnC family transcriptional regulator | - |
NFI99_RS12220 (NFI99_12210) | 9328..11703 | + | 2376 | WP_232252305.1 | TonB-dependent receptor | - |
NFI99_RS12225 (NFI99_12215) | 11735..12481 | + | 747 | WP_232252306.1 | energy transducer TonB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..154173 | 154173 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12389.37 Da Isoelectric Point: 8.8909
>T249128 WP_012734107.1 NZ_CP099584:7353-7703 [Burkholderia glumae]
MVKRVKFERGDIVRVSLSPTVGREQQGDFRPALVLSPAAFNALGVALVAPITQGGEFARFAGFAVPLSGSGTETQGVALV
NMVRMLDLEGRGARKIERAPVEVVEDALARLQTIIE
MVKRVKFERGDIVRVSLSPTVGREQQGDFRPALVLSPAAFNALGVALVAPITQGGEFARFAGFAVPLSGSGTETQGVALV
NMVRMLDLEGRGARKIERAPVEVVEDALARLQTIIE
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A246MF70 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A246MFN5 |