Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 1701875..1702650 | Replicon | chromosome |
| Accession | NZ_CP099583 | ||
| Organism | Burkholderia glumae strain GR20004 | ||
Toxin (Protein)
| Gene name | TacT2 | Uniprot ID | C5AIF4 |
| Locus tag | NFI99_RS06865 | Protein ID | WP_015877380.1 |
| Coordinates | 1701875..1702372 (-) | Length | 166 a.a. |
Antitoxin (Protein)
| Gene name | TacA2 | Uniprot ID | C5AIF5 |
| Locus tag | NFI99_RS06870 | Protein ID | WP_015877381.1 |
| Coordinates | 1702369..1702650 (-) | Length | 94 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NFI99_RS06830 (NFI99_06825) | 1697329..1698678 | + | 1350 | WP_015877376.1 | allantoin permease | - |
| NFI99_RS06835 (NFI99_06830) | 1698764..1698859 | - | 96 | Protein_1359 | IS5/IS1182 family transposase | - |
| NFI99_RS06840 (NFI99_06835) | 1698931..1699476 | - | 546 | Protein_1360 | IS3 family transposase | - |
| NFI99_RS06845 (NFI99_06840) | 1699599..1699883 | - | 285 | WP_153478924.1 | hypothetical protein | - |
| NFI99_RS06850 (NFI99_06845) | 1699900..1700151 | - | 252 | WP_230674552.1 | hypothetical protein | - |
| NFI99_RS06855 (NFI99_06850) | 1700281..1700883 | - | 603 | Protein_1363 | RHS domain-containing protein | - |
| NFI99_RS06860 (NFI99_06855) | 1701297..1701794 | - | 498 | WP_015877379.1 | ProQ/FINO family protein | - |
| NFI99_RS06865 (NFI99_06860) | 1701875..1702372 | - | 498 | WP_015877380.1 | GNAT family N-acetyltransferase | Toxin |
| NFI99_RS06870 (NFI99_06865) | 1702369..1702650 | - | 282 | WP_015877381.1 | DUF1778 domain-containing protein | Antitoxin |
| NFI99_RS06875 (NFI99_06870) | 1702647..1703024 | - | 378 | WP_173941242.1 | hypothetical protein | - |
| NFI99_RS06880 (NFI99_06875) | 1703107..1703469 | - | 363 | WP_017432434.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 1691256..1717406 | 26150 | |
| - | flank | IS/Tn | - | - | 1698907..1699449 | 542 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 166 a.a. Molecular weight: 17544.11 Da Isoelectric Point: 9.6894
>T249127 WP_015877380.1 NZ_CP099583:c1702372-1701875 [Burkholderia glumae]
VTGWRAPEPLSDAHGLDDFDSGVASLDTWLKRRALANQRSGASRTFVATRDGRVGAYYALASGAVTLEVAPGRFRRNMPD
PIPVVVLGRLAVDRAHQGIGVGRALVRDAGLRVLHAAAAIGIRGLIVHALSDSAKAFYERVGFEASPLDPMLLLITLADL
EHALS
VTGWRAPEPLSDAHGLDDFDSGVASLDTWLKRRALANQRSGASRTFVATRDGRVGAYYALASGAVTLEVAPGRFRRNMPD
PIPVVVLGRLAVDRAHQGIGVGRALVRDAGLRVLHAAAAIGIRGLIVHALSDSAKAFYERVGFEASPLDPMLLLITLADL
EHALS
Download Length: 498 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2J9HNC8 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2J9HNC9 |