Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tsbAT/- |
Location | 1992781..1993557 | Replicon | chromosome |
Accession | NZ_CP099576 | ||
Organism | Staphylococcus aureus strain MRSA1369 |
Toxin (Protein)
Gene name | tsbT | Uniprot ID | X5E2E6 |
Locus tag | NHB12_RS09730 | Protein ID | WP_000031108.1 |
Coordinates | 1992781..1992933 (-) | Length | 51 a.a. |
Antitoxin (Protein)
Gene name | tsbA | Uniprot ID | W8U4V4 |
Locus tag | NHB12_RS09735 | Protein ID | WP_001251224.1 |
Coordinates | 1992958..1993557 (-) | Length | 200 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NHB12_RS09715 (1988744) | 1988744..1989565 | + | 822 | WP_000669376.1 | RluA family pseudouridine synthase | - |
NHB12_RS09720 (1990028) | 1990028..1991413 | - | 1386 | WP_000116224.1 | class II fumarate hydratase | - |
NHB12_RS09725 (1991609) | 1991609..1992004 | - | 396 | WP_000901021.1 | hypothetical protein | - |
NHB12_RS09730 (1992781) | 1992781..1992933 | - | 153 | WP_000031108.1 | SAS053 family protein | Toxin |
NHB12_RS09735 (1992958) | 1992958..1993557 | - | 600 | WP_001251224.1 | glucosamine-6-phosphate isomerase | Antitoxin |
NHB12_RS09740 (1993716) | 1993716..1994186 | - | 471 | WP_000181398.1 | tRNA (uridine(34)/cytosine(34)/5- carboxymethylaminomethyluridine(34)-2'-O)- methyltransferase TrmL | - |
NHB12_RS09745 (1994191) | 1994191..1995318 | - | 1128 | WP_000379978.1 | tRNA epoxyqueuosine(34) reductase QueG | - |
NHB12_RS09750 (1995469) | 1995469..1996191 | - | 723 | WP_000590809.1 | amino acid ABC transporter ATP-binding protein | - |
NHB12_RS09755 (1996184) | 1996184..1997641 | - | 1458 | WP_000649907.1 | ABC transporter permease subunit | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5936.28 Da Isoelectric Point: 3.8962
>T249117 WP_000031108.1 NZ_CP099576:c1992933-1992781 [Staphylococcus aureus]
MSKDKDPKLNYHEEENSMVTDFEDLKELGKEMEQISDQNDQEKNSEEDSQ
MSKDKDPKLNYHEEENSMVTDFEDLKELGKEMEQISDQNDQEKNSEEDSQ
Download Length: 153 bp
Antitoxin
Download Length: 200 a.a. Molecular weight: 22343.47 Da Isoelectric Point: 5.1445
>AT249117 WP_001251224.1 NZ_CP099576:c1993557-1992958 [Staphylococcus aureus]
MAMNFKVFDNSQLVAEYAADIIRKQFNNNPTTIAGFHLDTDQAPVLDELKKNVEKHAVDFSQINILDYDDKKSYFEALGV
PAGQVYPIAYEKDAIELIADKIKTKENKGKLTLQVVSIDEQGKLNVSIRQGLMEAREIFLVVTGANKRDVVEKLYQENGK
TSFEPADLKAHRMVNVILDKEAAAGLPEDVKAYFTSRFA
MAMNFKVFDNSQLVAEYAADIIRKQFNNNPTTIAGFHLDTDQAPVLDELKKNVEKHAVDFSQINILDYDDKKSYFEALGV
PAGQVYPIAYEKDAIELIADKIKTKENKGKLTLQVVSIDEQGKLNVSIRQGLMEAREIFLVVTGANKRDVVEKLYQENGK
TSFEPADLKAHRMVNVILDKEAAAGLPEDVKAYFTSRFA
Download Length: 600 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|