249115

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsaAT/-
Location 888377..888854 Replicon chromosome
Accession NZ_CP099576
Organism Staphylococcus aureus strain MRSA1369

Toxin (Protein)


Gene name TsaT Uniprot ID Q2G005
Locus tag NHB12_RS04280 Protein ID WP_000052078.1
Coordinates 888377..888565 (-) Length 63 a.a.

Antitoxin (Protein)


Gene name TsaA Uniprot ID T1Y6P8
Locus tag NHB12_RS04285 Protein ID WP_001059690.1
Coordinates 888594..888854 (-) Length 87 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NHB12_RS04250 (884418) 884418..884888 + 471 WP_000824472.1 hypothetical protein -
NHB12_RS04255 (885229) 885229..885915 + 687 WP_001548082.1 thermonuclease family protein -
NHB12_RS04260 (886272) 886272..886472 + 201 WP_001059082.1 cold-shock protein -
NHB12_RS04265 (886968) 886968..887186 - 219 WP_000005886.1 hypothetical protein -
NHB12_RS04270 (887248) 887248..887532 - 285 WP_001004395.1 hypothetical protein -
NHB12_RS04275 (887620) 887620..888189 - 570 WP_001106654.1 lipoprotein N-acylation protein LnsA -
NHB12_RS04280 (888377) 888377..888565 - 189 WP_000052078.1 hypothetical protein Toxin
NHB12_RS04285 (888594) 888594..888854 - 261 WP_001059690.1 hypothetical protein Antitoxin
NHB12_RS04290 (889195) 889195..889398 + 204 WP_000145163.1 sterile alpha motif-like domain-containing protein -
NHB12_RS04295 (889395) 889395..889631 - 237 WP_000368687.1 hypothetical protein -
NHB12_RS04300 (889856) 889856..890437 + 582 WP_001140686.1 histidine phosphatase family protein -
NHB12_RS04305 (890510) 890510..891127 - 618 WP_000255561.1 LysE/ArgO family amino acid transporter -
NHB12_RS04310 (891282) 891282..891776 - 495 WP_000569884.1 GNAT family N-acetyltransferase -
NHB12_RS04315 (892175) 892175..892597 - 423 WP_000974460.1 organic hydroperoxide resistance protein -
NHB12_RS04320 (892745) 892745..893461 + 717 WP_000150017.1 type I 3-dehydroquinate dehydratase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - selk / selq 883061..914143 31082


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 63 a.a.        Molecular weight: 7172.84 Da        Isoelectric Point: 9.9971

>T249115 WP_000052078.1 NZ_CP099576:c888565-888377 [Staphylococcus aureus]
MSLHFAILFWLALIFLVAATFILVLMKKTSKESKKESYLSFTVILYIFGFAILIYTFIFGVL

Download         Length: 189 bp

Antitoxin


Download         Length: 87 a.a.        Molecular weight: 9940.09 Da        Isoelectric Point: 4.0624

>AT249115 WP_001059690.1 NZ_CP099576:c888854-888594 [Staphylococcus aureus]
MNNILLNAINIVITTTFVIFNILITYNKDLDDLCWLLPGIIICGVILIVSFTIAMITKNWLSEILFFINIVLVLYYIYPI
FYSFIG

Download         Length: 261 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0D6HZ40

Antitoxin

Source ID Structure
AlphaFold DB A0A0E0VN56

References