Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PumAB/upstrm_HI1419-DUF971 |
Location | 5239581..5240169 | Replicon | chromosome |
Accession | NZ_CP099575 | ||
Organism | Pseudomonas kermanshahensis strain F8 |
Toxin (Protein)
Gene name | PumA | Uniprot ID | - |
Locus tag | NG836_RS23545 | Protein ID | WP_252825351.1 |
Coordinates | 5239581..5239883 (+) | Length | 101 a.a. |
Antitoxin (Protein)
Gene name | PumB | Uniprot ID | - |
Locus tag | NG836_RS23550 | Protein ID | WP_027593133.1 |
Coordinates | 5239876..5240169 (+) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NG836_RS26960 | 5235543..5235671 | - | 129 | WP_256214945.1 | PA1414 family protein | - |
NG836_RS23525 (NG836_23525) | 5235796..5236689 | - | 894 | WP_252825348.1 | LysR family transcriptional regulator | - |
NG836_RS23530 (NG836_23530) | 5236796..5237995 | + | 1200 | WP_252825349.1 | YbfB/YjiJ family MFS transporter | - |
NG836_RS23535 (NG836_23535) | 5238024..5238950 | - | 927 | WP_099430143.1 | DMT family transporter | - |
NG836_RS23540 (NG836_23540) | 5239056..5239451 | - | 396 | WP_027593132.1 | hypothetical protein | - |
NG836_RS23545 (NG836_23545) | 5239581..5239883 | + | 303 | WP_252825351.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NG836_RS23550 (NG836_23550) | 5239876..5240169 | + | 294 | WP_027593133.1 | putative addiction module antidote protein | Antitoxin |
NG836_RS23555 (NG836_23555) | 5240282..5240554 | + | 273 | WP_099455003.1 | hypothetical protein | - |
NG836_RS23560 (NG836_23560) | 5240611..5241972 | - | 1362 | WP_027593135.1 | DEAD/DEAH box helicase | - |
NG836_RS23565 (NG836_23565) | 5242077..5243363 | + | 1287 | WP_099455004.1 | mechanosensitive ion channel family protein | - |
NG836_RS23570 (NG836_23570) | 5243478..5244413 | - | 936 | WP_252825353.1 | AEC family transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 5231862..5250841 | 18979 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11432.12 Da Isoelectric Point: 10.5383
>T249113 WP_252825351.1 NZ_CP099575:5239581-5239883 [Pseudomonas kermanshahensis]
MKKIESSSFRHWVHGLRDEMARIRIIARINRLMEGLSGDVSAVGHGVSELRIHHGPGYRVYFHQAGDTLVILLCGGDKSS
QRRDIKAAHEILRSWRMQND
MKKIESSSFRHWVHGLRDEMARIRIIARINRLMEGLSGDVSAVGHGVSELRIHHGPGYRVYFHQAGDTLVILLCGGDKSS
QRRDIKAAHEILRSWRMQND
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|