Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
Location | 2021169..2021737 | Replicon | chromosome |
Accession | NZ_CP099556 | ||
Organism | Aliarcobacter cryaerophilus strain ICDCAC48 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | - |
Locus tag | NGX11_RS10590 | Protein ID | WP_260947991.1 |
Coordinates | 2021169..2021501 (-) | Length | 111 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | - |
Locus tag | NGX11_RS10595 | Protein ID | WP_263514512.1 |
Coordinates | 2021495..2021737 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NGX11_RS10570 (NGX11_10520) | 2016627..2017190 | + | 564 | WP_066165328.1 | YceI family protein | - |
NGX11_RS10575 (NGX11_10525) | 2017231..2018436 | - | 1206 | WP_263514510.1 | tryptophan synthase subunit beta | - |
NGX11_RS10580 (NGX11_10530) | 2018500..2019792 | + | 1293 | WP_187472906.1 | saccharopine dehydrogenase C-terminal domain-containing protein | - |
NGX11_RS10585 (NGX11_10535) | 2019863..2021179 | + | 1317 | WP_263514511.1 | aminotransferase class V-fold PLP-dependent enzyme | - |
NGX11_RS10590 (NGX11_10540) | 2021169..2021501 | - | 333 | WP_260947991.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
NGX11_RS10595 (NGX11_10545) | 2021495..2021737 | - | 243 | WP_263514512.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
NGX11_RS10600 (NGX11_10550) | 2021891..2022484 | - | 594 | WP_260875402.1 | porin family protein | - |
NGX11_RS10605 (NGX11_10555) | 2022577..2022867 | + | 291 | WP_236778534.1 | helix-turn-helix transcriptional regulator | - |
NGX11_RS10610 (NGX11_10560) | 2022913..2024064 | + | 1152 | WP_263514513.1 | metallophosphoesterase | - |
NGX11_RS10615 (NGX11_10565) | 2024076..2024492 | - | 417 | WP_066156012.1 | Hsp20/alpha crystallin family protein | - |
NGX11_RS10620 (NGX11_10570) | 2024595..2025038 | - | 444 | WP_066404045.1 | hemerythrin family protein | - |
NGX11_RS10625 (NGX11_10575) | 2025105..2026151 | - | 1047 | WP_263514514.1 | sulfate ABC transporter ATP-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 111 a.a. Molecular weight: 12493.56 Da Isoelectric Point: 9.5322
>T249110 WP_260947991.1 NZ_CP099556:c2021501-2021169 [Aliarcobacter cryaerophilus]
MVNYIPSKGDIVTLDFDPQKGHEQKGRRPALILSNKTFNKALGLAFACPITSTKRDFPFHIKIQSQKISGFIMAEQLKSI
DYNSRNIKFVEKVDKEILEEIEAIVDAIIK
MVNYIPSKGDIVTLDFDPQKGHEQKGRRPALILSNKTFNKALGLAFACPITSTKRDFPFHIKIQSQKISGFIMAEQLKSI
DYNSRNIKFVEKVDKEILEEIEAIVDAIIK
Download Length: 333 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|