Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907(toxin) |
Location | 1885932..1886497 | Replicon | chromosome |
Accession | NZ_CP099551 | ||
Organism | Lactiplantibacillus pentosus strain KW1 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | F6IUY4 |
Locus tag | NGP02_RS08335 | Protein ID | WP_050339912.1 |
Coordinates | 1886150..1886497 (+) | Length | 116 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | - |
Locus tag | NGP02_RS08330 | Protein ID | WP_082230320.1 |
Coordinates | 1885932..1886150 (+) | Length | 73 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NGP02_RS08315 | 1881547..1883589 | + | 2043 | WP_252701470.1 | KUP/HAK/KT family potassium transporter | - |
NGP02_RS08320 | 1883657..1884304 | - | 648 | WP_225351393.1 | N-acetyltransferase | - |
NGP02_RS08325 | 1884443..1885174 | - | 732 | WP_050339911.1 | hypothetical protein | - |
NGP02_RS08330 | 1885932..1886150 | + | 219 | WP_082230320.1 | hypothetical protein | Antitoxin |
NGP02_RS08335 | 1886150..1886497 | + | 348 | WP_050339912.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
NGP02_RS08340 | 1886917..1887960 | - | 1044 | WP_021337327.1 | AI-2E family transporter | - |
NGP02_RS08345 | 1888413..1889537 | + | 1125 | WP_050339913.1 | vitamin B12 independent methionine synthase | - |
NGP02_RS08350 | 1889692..1890072 | - | 381 | WP_225351394.1 | multidrug efflux SMR transporter | - |
NGP02_RS08355 | 1890092..1890400 | - | 309 | WP_003639898.1 | SMR family transporter | - |
NGP02_RS08360 | 1890776..1891414 | - | 639 | WP_050339915.1 | hemolysin III family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 116 a.a. Molecular weight: 13406.29 Da Isoelectric Point: 9.4892
>T249108 WP_050339912.1 NZ_CP099551:1886150-1886497 [Lactiplantibacillus pentosus]
MTYLPKQKDIIWIDFDPQRGREIKKRRPAVILSSNLYTQNTGFVIVSPITSTIHDLPGYFSLNGYDIHGQVVAAQIYSFD
ARPKAGRNITYIETMRNVDFYRVAQTVYYNFDFPF
MTYLPKQKDIIWIDFDPQRGREIKKRRPAVILSSNLYTQNTGFVIVSPITSTIHDLPGYFSLNGYDIHGQVVAAQIYSFD
ARPKAGRNITYIETMRNVDFYRVAQTVYYNFDFPF
Download Length: 348 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|