Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relE-yefM/YoeB-RelB |
Location | 1646864..1647381 | Replicon | chromosome |
Accession | NZ_CP099547 | ||
Organism | Arcanobacterium pinnipediorum strain DSM 28752 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | NG665_RS07345 | Protein ID | WP_252673061.1 |
Coordinates | 1646864..1647118 (-) | Length | 85 a.a. |
Antitoxin (Protein)
Gene name | yefM | Uniprot ID | - |
Locus tag | NG665_RS07350 | Protein ID | WP_252673062.1 |
Coordinates | 1647124..1647381 (-) | Length | 86 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NG665_RS07325 (NG665_07325) | 1642178..1643455 | - | 1278 | WP_252673057.1 | ABC transporter substrate-binding protein | - |
NG665_RS07330 (NG665_07330) | 1643728..1645557 | + | 1830 | WP_252673058.1 | hypothetical protein | - |
NG665_RS07335 (NG665_07335) | 1645644..1646087 | - | 444 | WP_252673059.1 | GNAT family N-acetyltransferase | - |
NG665_RS07340 (NG665_07340) | 1646163..1646669 | - | 507 | WP_252673060.1 | GNAT family N-acetyltransferase | - |
NG665_RS07345 (NG665_07345) | 1646864..1647118 | - | 255 | WP_252673061.1 | Txe/YoeB family addiction module toxin | Toxin |
NG665_RS07350 (NG665_07350) | 1647124..1647381 | - | 258 | WP_252673062.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | Antitoxin |
NG665_RS07355 (NG665_07355) | 1647657..1648736 | - | 1080 | WP_252673063.1 | redox-regulated ATPase YchF | - |
NG665_RS07360 (NG665_07360) | 1648872..1650092 | + | 1221 | WP_252673064.1 | DNA recombination protein RmuC | - |
NG665_RS07365 (NG665_07365) | 1650198..1651304 | - | 1107 | WP_252674106.1 | 4-hydroxy-3-methylbut-2-enyl diphosphate reductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 85 a.a. Molecular weight: 10280.73 Da Isoelectric Point: 9.2456
>T249106 WP_252673061.1 NZ_CP099547:c1647118-1646864 [Arcanobacterium pinnipediorum]
VKYVWDENAWQDYLWWQAHDRKMLKRINLLLKDISRNGNEGIGKPEPLKYELAGYWSRRISDEHRLVFKYTETAVYIAAC
RYHY
VKYVWDENAWQDYLWWQAHDRKMLKRINLLLKDISRNGNEGIGKPEPLKYELAGYWSRRISDEHRLVFKYTETAVYIAAC
RYHY
Download Length: 255 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|