Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
| Location | 212531..213051 | Replicon | plasmid unnamed |
| Accession | NZ_CP099541 | ||
| Organism | Pantoea stewartii strain HR3-48 | ||
Toxin (Protein)
| Gene name | ccdB | Uniprot ID | H3RK38 |
| Locus tag | NG832_RS21575 | Protein ID | WP_006121898.1 |
| Coordinates | 212752..213051 (+) | Length | 100 a.a. |
Antitoxin (Protein)
| Gene name | ccdA | Uniprot ID | H3RK39 |
| Locus tag | NG832_RS21570 | Protein ID | WP_006121899.1 |
| Coordinates | 212531..212749 (+) | Length | 73 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NG832_RS21545 (NG832_21485) | 208677..209576 | + | 900 | WP_185200244.1 | hypothetical protein | - |
| NG832_RS21550 (NG832_21490) | 209585..210793 | + | 1209 | WP_263759584.1 | response regulator | - |
| NG832_RS21555 (NG832_21495) | 210790..211128 | + | 339 | WP_033742520.1 | STAS domain-containing protein | - |
| NG832_RS21560 (NG832_21500) | 211130..211555 | + | 426 | WP_263759587.1 | ATP-binding protein | - |
| NG832_RS21565 (NG832_21505) | 211758..212018 | - | 261 | WP_054633991.1 | hypothetical protein | - |
| NG832_RS21570 (NG832_21510) | 212531..212749 | + | 219 | WP_006121899.1 | type II toxin-antitoxin system CcdA family antitoxin | Antitoxin |
| NG832_RS21575 (NG832_21515) | 212752..213051 | + | 300 | WP_006121898.1 | CcdB family protein | Toxin |
| NG832_RS21580 (NG832_21520) | 213220..213915 | - | 696 | WP_054633989.1 | ROK family protein | - |
| NG832_RS21585 (NG832_21525) | 213933..215303 | - | 1371 | WP_054633988.1 | glucose-6-phosphate dehydrogenase | - |
| NG832_RS21590 (NG832_21530) | 215321..216325 | - | 1005 | WP_039339386.1 | decarboxylating 6-phosphogluconate dehydrogenase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | sul1 / qacE / aadA2 | fliC | 1..333832 | 333832 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 100 a.a. Molecular weight: 10974.67 Da Isoelectric Point: 7.0045
>T249096 WP_006121898.1 NZ_CP099541:212752-213051 [Pantoea stewartii]
MQFDVYSHKNGKKYPYLVEVQSYLIDTPGRLMVAPLALPGEFVGSGELYPEVLVNGSKYRVVTTDIASVPVKALGDKVGD
VSQYEAAIKNAIFRLFWGF
MQFDVYSHKNGKKYPYLVEVQSYLIDTPGRLMVAPLALPGEFVGSGELYPEVLVNGSKYRVVTTDIASVPVKALGDKVGD
VSQYEAAIKNAIFRLFWGF
Download Length: 300 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|