Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 2369423..2370040 Replicon chromosome
Accession NZ_CP099540
Organism Pantoea stewartii strain HR3-48

Toxin (Protein)


Gene name Hha Uniprot ID H3R994
Locus tag NG832_RS10920 Protein ID WP_006117940.1
Coordinates 2369825..2370040 (+) Length 72 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID A0A6G6JU23
Locus tag NG832_RS10915 Protein ID WP_039338473.1
Coordinates 2369423..2369800 (+) Length 126 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NG832_RS10885 (NG832_10855) 2365714..2365968 + 255 WP_058708287.1 type B 50S ribosomal protein L31 -
NG832_RS10890 (NG832_10860) 2365980..2366120 + 141 WP_006117931.1 type B 50S ribosomal protein L36 -
NG832_RS10895 (NG832_10865) 2366178..2367056 - 879 WP_263756879.1 metal ABC transporter substrate-binding protein -
NG832_RS10900 (NG832_10870) 2367069..2367908 - 840 WP_006117933.1 metal ABC transporter permease -
NG832_RS10905 (NG832_10875) 2367905..2368573 - 669 WP_205957337.1 ATP-binding cassette domain-containing protein -
NG832_RS10910 (NG832_10880) 2368923..2369276 + 354 WP_185199664.1 hypothetical protein -
NG832_RS10915 (NG832_10885) 2369423..2369800 + 378 WP_039338473.1 Hha toxicity modulator TomB Antitoxin
NG832_RS10920 (NG832_10890) 2369825..2370040 + 216 WP_006117940.1 HHA domain-containing protein Toxin
NG832_RS10930 (NG832_10900) 2370466..2370780 + 315 WP_054688065.1 MGMT family protein -
NG832_RS10935 (NG832_10905) 2370821..2371378 - 558 WP_006117943.1 YbaY family lipoprotein -
NG832_RS10940 (NG832_10910) 2371571..2372434 + 864 WP_006117944.1 acyl-CoA thioesterase II -
NG832_RS10945 (NG832_10915) 2372483..2373769 - 1287 WP_033738675.1 ammonium transporter AmtB -
NG832_RS10950 (NG832_10920) 2373803..2374141 - 339 WP_003850469.1 P-II family nitrogen regulator -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(12-68)

Antitoxin

Biofilm formation regulator YbaJ

(1-114)


Sequences

Toxin        


Download         Length: 72 a.a.        Molecular weight: 8528.91 Da        Isoelectric Point: 9.4825

>T249095 WP_006117940.1 NZ_CP099540:2369825-2370040 [Pantoea stewartii]
MNKTLTKTDYLMRLRRCRSIDTLERVIEKNKYELSDDELAVFYSAADHRLAELTMNKLYDKVPVSVWKFVR

Download         Length: 216 bp

Antitoxin


Download         Length: 126 a.a.        Molecular weight: 14622.23 Da        Isoelectric Point: 4.4699

>AT249095 WP_039338473.1 NZ_CP099540:2369423-2369800 [Pantoea stewartii]
MDEYSPKRHDIAQLKYVCESLFDASMATLTDSHHGWVNDPTADGNLQLNDLIEHIASFTMNYKIKHAEDEALITQIDEYL
DDTFMLFSNYSVNTQDLQRWQRSAKRLFNLFQEECAYLQQPSHSL

Download         Length: 378 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB H3R994

Antitoxin

Source ID Structure
AlphaFold DB A0A6G6JU23

References