Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 2690872..2691489 | Replicon | chromosome |
Accession | NZ_CP099535 | ||
Organism | Pantoea ananatis strain JT1-188 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | - |
Locus tag | NG826_RS12745 | Protein ID | WP_028723979.1 |
Coordinates | 2691274..2691489 (+) | Length | 72 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | - |
Locus tag | NG826_RS12740 | Protein ID | WP_028723978.1 |
Coordinates | 2690872..2691249 (+) | Length | 126 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NG826_RS12710 (NG826_12670) | 2687158..2687412 | + | 255 | WP_014606427.1 | type B 50S ribosomal protein L31 | - |
NG826_RS12715 (NG826_12675) | 2687424..2687564 | + | 141 | WP_014606428.1 | type B 50S ribosomal protein L36 | - |
NG826_RS12720 (NG826_12680) | 2687624..2688502 | - | 879 | WP_028723975.1 | metal ABC transporter substrate-binding protein | - |
NG826_RS12725 (NG826_12685) | 2688515..2689354 | - | 840 | WP_013024907.1 | metal ABC transporter permease | - |
NG826_RS12730 (NG826_12690) | 2689351..2690019 | - | 669 | WP_263793366.1 | ABC transporter ATP-binding protein | - |
NG826_RS12735 (NG826_12695) | 2690372..2690725 | + | 354 | WP_028723977.1 | hypothetical protein | - |
NG826_RS12740 (NG826_12700) | 2690872..2691249 | + | 378 | WP_028723978.1 | Hha toxicity modulator TomB | Antitoxin |
NG826_RS12745 (NG826_12705) | 2691274..2691489 | + | 216 | WP_028723979.1 | HHA domain-containing protein | Toxin |
NG826_RS12755 (NG826_12715) | 2691887..2692198 | + | 312 | WP_263793367.1 | MGMT family protein | - |
NG826_RS12760 (NG826_12720) | 2692247..2692804 | - | 558 | WP_013024901.1 | YbaY family lipoprotein | - |
NG826_RS12765 (NG826_12725) | 2692997..2693860 | + | 864 | WP_064365625.1 | acyl-CoA thioesterase II | - |
NG826_RS12770 (NG826_12730) | 2693907..2695196 | - | 1290 | WP_028723982.1 | ammonium transporter AmtB | - |
NG826_RS12775 (NG826_12735) | 2695231..2695569 | - | 339 | WP_013024898.1 | P-II family nitrogen regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 72 a.a. Molecular weight: 8542.94 Da Isoelectric Point: 9.4825
>T249093 WP_028723979.1 NZ_CP099535:2691274-2691489 [Pantoea ananatis]
MNKTLTKTDYLMRLRRCRSIDTLERVIEKNKYELSDEELAVFYSAADHRLAELTMNKLYDKVPVSVWKFVR
MNKTLTKTDYLMRLRRCRSIDTLERVIEKNKYELSDEELAVFYSAADHRLAELTMNKLYDKVPVSVWKFVR
Download Length: 216 bp
Antitoxin
Download Length: 126 a.a. Molecular weight: 14709.35 Da Isoelectric Point: 4.4069
>AT249093 WP_028723978.1 NZ_CP099535:2690872-2691249 [Pantoea ananatis]
MDEYSPKRHDIAQLKYLCESLFDESMATLTDSHHGWVNDPTAESNLQLNDLIEHIASFTMNYKIKHVEDEALITQIDEYL
DDTFMLFSNYSVNTQDLQRWQRSAKRLFNVFTEECAFLQQPSHSL
MDEYSPKRHDIAQLKYLCESLFDESMATLTDSHHGWVNDPTAESNLQLNDLIEHIASFTMNYKIKHVEDEALITQIDEYL
DDTFMLFSNYSVNTQDLQRWQRSAKRLFNVFTEECAFLQQPSHSL
Download Length: 378 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|