Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
Location | 507341..508079 | Replicon | chromosome |
Accession | NZ_CP099535 | ||
Organism | Pantoea ananatis strain JT1-188 |
Toxin (Protein)
Gene name | yeeV | Uniprot ID | - |
Locus tag | NG826_RS02455 | Protein ID | WP_144839663.1 |
Coordinates | 507341..507721 (-) | Length | 127 a.a. |
Antitoxin (Protein)
Gene name | yeeU | Uniprot ID | - |
Locus tag | NG826_RS02460 | Protein ID | WP_144839661.1 |
Coordinates | 507753..508079 (-) | Length | 109 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NG826_RS02430 (NG826_02430) | 503259..505274 | + | 2016 | WP_260411985.1 | fimbria/pilus outer membrane usher protein | - |
NG826_RS02435 (NG826_02435) | 505246..505950 | + | 705 | WP_263793792.1 | fimbria/pilus periplasmic chaperone | - |
NG826_RS02440 (NG826_02440) | 506270..506407 | - | 138 | Protein_470 | IS3 family transposase | - |
NG826_RS02445 (NG826_02445) | 506451..506768 | - | 318 | Protein_471 | integrase core domain-containing protein | - |
NG826_RS02450 (NG826_02450) | 507135..507344 | - | 210 | WP_144839665.1 | DUF5983 family protein | - |
NG826_RS02455 (NG826_02455) | 507341..507721 | - | 381 | WP_144839663.1 | TA system toxin CbtA family protein | Toxin |
NG826_RS02460 (NG826_02460) | 507753..508079 | - | 327 | WP_144839661.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
NG826_RS02465 (NG826_02465) | 508090..508557 | - | 468 | WP_144839659.1 | DNA repair protein RadC | - |
NG826_RS02470 (NG826_02470) | 508572..508991 | - | 420 | WP_248260975.1 | antirestriction protein | - |
NG826_RS02475 (NG826_02475) | 509122..509643 | - | 522 | WP_248260976.1 | IrmA family protein | - |
NG826_RS02480 (NG826_02480) | 509619..510248 | - | 630 | WP_248260977.1 | hypothetical protein | - |
NG826_RS02485 (NG826_02485) | 510254..510955 | - | 702 | WP_039270018.1 | WYL domain-containing protein | - |
NG826_RS02490 (NG826_02490) | 511168..512043 | - | 876 | WP_248260978.1 | GTPase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 506451..506771 | 320 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 127 a.a. Molecular weight: 13851.75 Da Isoelectric Point: 6.0622
>T249088 WP_144839663.1 NZ_CP099535:c507721-507341 [Pantoea ananatis]
MQTLPLPEPRAAEPCPSPVQVWQLLLTHLLDKHYGLTLNDTPFGDDSVIQAHINAGISLCDAVNFIVERYELVRTDHSCF
SLTERSSLIGAIDILRARRATGLIVSSGYSTITRITTGRYQGGEAQ
MQTLPLPEPRAAEPCPSPVQVWQLLLTHLLDKHYGLTLNDTPFGDDSVIQAHINAGISLCDAVNFIVERYELVRTDHSCF
SLTERSSLIGAIDILRARRATGLIVSSGYSTITRITTGRYQGGEAQ
Download Length: 381 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|