Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 131422..132074 | Replicon | chromosome |
| Accession | NZ_CP099535 | ||
| Organism | Pantoea ananatis strain JT1-188 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | - |
| Locus tag | NG826_RS00620 | Protein ID | WP_033778077.1 |
| Coordinates | 131676..132074 (+) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | - |
| Locus tag | NG826_RS00615 | Protein ID | WP_028724117.1 |
| Coordinates | 131422..131652 (+) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NG826_RS00600 (NG826_00600) | 127394..128602 | + | 1209 | WP_263793723.1 | conjugal transfer protein TraF | - |
| NG826_RS00605 (NG826_00605) | 128656..129210 | + | 555 | WP_263775424.1 | hypothetical protein | - |
| NG826_RS00610 (NG826_00610) | 129676..130834 | - | 1159 | Protein_119 | IS30 family transposase | - |
| NG826_RS00615 (NG826_00615) | 131422..131652 | + | 231 | WP_028724117.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| NG826_RS00620 (NG826_00620) | 131676..132074 | + | 399 | WP_033778077.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| NG826_RS00625 (NG826_00625) | 132301..133176 | - | 876 | WP_050598417.1 | N-acetylmuramoyl-L-alanine amidase | - |
| NG826_RS00630 (NG826_00630) | 133206..133487 | - | 282 | WP_028724120.1 | LuxR C-terminal-related transcriptional regulator | - |
| NG826_RS00635 (NG826_00635) | 133896..134453 | + | 558 | WP_028724121.1 | fimbrial protein | - |
| NG826_RS00640 (NG826_00640) | 134516..135187 | + | 672 | WP_028724122.1 | fimbria/pilus periplasmic chaperone | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 130235..181522 | 51287 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14290.62 Da Isoelectric Point: 7.2161
>T249087 WP_033778077.1 NZ_CP099535:131676-132074 [Pantoea ananatis]
MLDTCICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYAEMRFGASGPKASPRHVQLVDAFCARLDAVLPWDRAAVDAT
TEIKVSLRLAGTPIGPNDTAIAGHAITVGAILVTNNVREFARVPGLALEDWV
MLDTCICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYAEMRFGASGPKASPRHVQLVDAFCARLDAVLPWDRAAVDAT
TEIKVSLRLAGTPIGPNDTAIAGHAITVGAILVTNNVREFARVPGLALEDWV
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|