Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relB-parE/ParE-RHH |
Location | 1768..2348 | Replicon | plasmid pSZS128-ccl |
Accession | NZ_CP099525 | ||
Organism | Klebsiella pneumoniae strain SZS128 |
Toxin (Protein)
Gene name | parE | Uniprot ID | A0A8J3DTL7 |
Locus tag | NG894_RS28420 | Protein ID | WP_071177730.1 |
Coordinates | 2034..2348 (+) | Length | 105 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A2X1PRM1 |
Locus tag | NG894_RS28415 | Protein ID | WP_000093040.1 |
Coordinates | 1768..2046 (+) | Length | 93 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NG894_RS28400 (NG894_28380) | 341..586 | + | 246 | WP_032440458.1 | hypothetical protein | - |
NG894_RS28405 (NG894_28385) | 860..1231 | + | 372 | WP_001237044.1 | cell envelope integrity protein TolA | - |
NG894_RS28410 (NG894_28390) | 1228..1593 | + | 366 | WP_072354022.1 | TonB family protein | - |
NG894_RS28415 (NG894_28395) | 1768..2046 | + | 279 | WP_000093040.1 | CopG family ribbon-helix-helix protein | Antitoxin |
NG894_RS28420 (NG894_28400) | 2034..2348 | + | 315 | WP_071177730.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NG894_RS28425 (NG894_28405) | 2512..2940 | + | 429 | WP_001140599.1 | hypothetical protein | - |
NG894_RS28430 (NG894_28410) | 2966..3145 | + | 180 | WP_000165970.1 | Rop family plasmid primer RNA-binding protein | - |
NG894_RS28435 (NG894_28415) | 3172..3702 | - | 531 | WP_071177729.1 | hypothetical protein | - |
NG894_RS28440 (NG894_28420) | 3709..4440 | - | 732 | WP_071177728.1 | MobC family replication-relaxation protein | - |
NG894_RS28445 (NG894_28425) | 4440..6404 | - | 1965 | WP_071177727.1 | TraM recognition domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..10060 | 10060 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 11805.73 Da Isoelectric Point: 9.8324
>T249076 WP_071177730.1 NZ_CP099525:2034-2348 [Klebsiella pneumoniae]
MPQVTISALAQRDLQRLQDFLKTKNRLAARKGGEVIVRAIQQLKTLPDIGRPVPFLPLEYKELVIGFGDSGYVMLYRHDR
EMDQIVIVTVRHQKESGYPGADSL
MPQVTISALAQRDLQRLQDFLKTKNRLAARKGGEVIVRAIQQLKTLPDIGRPVPFLPLEYKELVIGFGDSGYVMLYRHDR
EMDQIVIVTVRHQKESGYPGADSL
Download Length: 315 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|