Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | stbDE/ParE-YafN |
Location | 222574..223096 | Replicon | plasmid pSZS128-Hv-MDR |
Accession | NZ_CP099523 | ||
Organism | Klebsiella pneumoniae strain SZS128 |
Toxin (Protein)
Gene name | stbE | Uniprot ID | A0A2J4R0S6 |
Locus tag | NG894_RS27655 | Protein ID | WP_004181778.1 |
Coordinates | 222812..223096 (+) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | stbD | Uniprot ID | A0A2J4R0U8 |
Locus tag | NG894_RS27650 | Protein ID | WP_004181777.1 |
Coordinates | 222574..222822 (+) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NG894_RS27630 (NG894_27615) | 217783..218604 | - | 822 | WP_004181772.1 | hypothetical protein | - |
NG894_RS27635 (NG894_27620) | 218666..219019 | - | 354 | WP_004181774.1 | hypothetical protein | - |
NG894_RS27640 (NG894_27625) | 219164..220150 | - | 987 | WP_101992392.1 | hypothetical protein | - |
NG894_RS27645 (NG894_27630) | 220484..222283 | - | 1800 | WP_004181776.1 | ATP-dependent helicase | - |
NG894_RS27650 (NG894_27635) | 222574..222822 | + | 249 | WP_004181777.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
NG894_RS27655 (NG894_27640) | 222812..223096 | + | 285 | WP_004181778.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NG894_RS27660 (NG894_27645) | 223113..223214 | - | 102 | Protein_241 | IS200/IS605 family transposase | - |
NG894_RS27665 (NG894_27650) | 223250..224476 | + | 1227 | WP_040209639.1 | RNA-guided endonuclease TnpB family protein | - |
NG894_RS27670 (NG894_27655) | 224747..224971 | - | 225 | Protein_243 | transposase | - |
NG894_RS27675 (NG894_27660) | 225050..225478 | - | 429 | WP_077257669.1 | IS200/IS605 family transposase | - |
NG894_RS27680 (NG894_27665) | 225514..226701 | + | 1188 | WP_040209642.1 | RNA-guided endonuclease TnpB family protein | - |
NG894_RS27685 (NG894_27670) | 226746..227117 | - | 372 | WP_040209644.1 | hypothetical protein | - |
NG894_RS27690 (NG894_27675) | 227114..227458 | - | 345 | WP_228306996.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | blaTEM-1B / aac(3)-IId / blaSHV-12 / qnrB4 / blaDHA-1 / sul1 / armA / msr(E) / mph(E) / mph(A) | rmpA / iutA / iucD / iucC / iucB / iucA | 1..302470 | 302470 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10970.69 Da Isoelectric Point: 10.6516
>T249073 WP_004181778.1 NZ_CP099523:222812-223096 [Klebsiella pneumoniae]
MTYKLAFNESALKEWKKLGHTIREQFKKKLAERLLNPRVPASQLHGRKDQYKIKLRGAGYRLVYSVNDDVVTVTVIGVGK
RENDDIYNLTKHRN
MTYKLAFNESALKEWKKLGHTIREQFKKKLAERLLNPRVPASQLHGRKDQYKIKLRGAGYRLVYSVNDDVVTVTVIGVGK
RENDDIYNLTKHRN
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2J4R0S6 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2J4R0U8 |