Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 185883..186409 | Replicon | plasmid pSZS128-Hv-MDR |
Accession | NZ_CP099523 | ||
Organism | Klebsiella pneumoniae strain SZS128 |
Toxin (Protein)
Gene name | relE | Uniprot ID | S1EXL1 |
Locus tag | NG894_RS27450 | Protein ID | WP_000323025.1 |
Coordinates | 185883..186170 (-) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | S1F6D3 |
Locus tag | NG894_RS27455 | Protein ID | WP_000534858.1 |
Coordinates | 186170..186409 (-) | Length | 80 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NG894_RS27420 (NG894_27405) | 180929..181162 | - | 234 | WP_004181905.1 | hypothetical protein | - |
NG894_RS27425 (NG894_27410) | 181241..181588 | - | 348 | WP_004181904.1 | hypothetical protein | - |
NG894_RS27430 (NG894_27415) | 181744..182811 | - | 1068 | WP_004181903.1 | hypothetical protein | - |
NG894_RS27435 (NG894_27420) | 183501..183878 | + | 378 | WP_004181901.1 | hypothetical protein | - |
NG894_RS27440 (NG894_27425) | 184076..185050 | - | 975 | WP_004181899.1 | hypothetical protein | - |
NG894_RS27445 (NG894_27430) | 185653..185811 | - | 159 | WP_004181898.1 | type I toxin-antitoxin system Hok family toxin | - |
NG894_RS27450 (NG894_27435) | 185883..186170 | - | 288 | WP_000323025.1 | type II toxin-antitoxin system mRNA interferase RelE | Toxin |
NG894_RS27455 (NG894_27440) | 186170..186409 | - | 240 | WP_000534858.1 | type II toxin-antitoxin system antitoxin RelB | Antitoxin |
NG894_RS27460 (NG894_27445) | 186434..186538 | + | 105 | Protein_201 | hypothetical protein | - |
NG894_RS27465 (NG894_27450) | 186672..187088 | - | 417 | Protein_202 | cation-efflux pump | - |
NG894_RS27470 (NG894_27455) | 187161..188329 | + | 1169 | WP_085929673.1 | IS3-like element ISEc52 family transposase | - |
NG894_RS27475 (NG894_27460) | 188339..188650 | - | 312 | Protein_204 | IS110 family transposase | - |
NG894_RS27480 (NG894_27465) | 189071..190411 | - | 1341 | WP_000589001.1 | ISNCY family transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | blaTEM-1B / aac(3)-IId / blaSHV-12 / qnrB4 / blaDHA-1 / sul1 / armA / msr(E) / mph(E) / mph(A) | rmpA / iutA / iucD / iucC / iucB / iucA | 1..302470 | 302470 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11225.22 Da Isoelectric Point: 10.1967
>T249072 WP_000323025.1 NZ_CP099523:c186170-185883 [Klebsiella pneumoniae]
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|