Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 107347..108017 Replicon plasmid pSZS128-Hv-MDR
Accession NZ_CP099523
Organism Klebsiella pneumoniae strain SZS128

Toxin (Protein)


Gene name vagD Uniprot ID Q6U619
Locus tag NG894_RS27045 Protein ID WP_004213072.1
Coordinates 107574..108017 (+) Length 148 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID Q6U620
Locus tag NG894_RS27040 Protein ID WP_004213073.1
Coordinates 107347..107577 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NG894_RS27015 (NG894_27000) 103570..104469 - 900 WP_004225022.1 nucleotide-binding protein -
NG894_RS27020 (NG894_27005) 104459..104749 - 291 WP_004213078.1 hypothetical protein -
NG894_RS27025 (NG894_27010) 105101..105307 + 207 WP_004213077.1 hypothetical protein -
NG894_RS27030 (NG894_27015) 105297..105590 - 294 WP_004213076.1 hypothetical protein -
NG894_RS27035 (NG894_27020) 105606..106739 - 1134 WP_004213075.1 DUF3800 domain-containing protein -
NG894_RS27040 (NG894_27025) 107347..107577 + 231 WP_004213073.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
NG894_RS27045 (NG894_27030) 107574..108017 + 444 WP_004213072.1 type II toxin-antitoxin system VapC family toxin Toxin
NG894_RS27050 (NG894_27035) 108166..108417 + 252 WP_186987481.1 hypothetical protein -
NG894_RS27055 (NG894_27040) 108440..108744 - 305 Protein_120 transposase -
NG894_RS27060 (NG894_27045) 109161..109795 + 635 Protein_121 mucoid phenotype regulator RmpA2 -
NG894_RS27065 (NG894_27050) 109864..110844 + 981 WP_000019445.1 IS5-like element ISKpn26 family transposase -
NG894_RS27070 (NG894_27055) 111513..111916 - 404 Protein_123 GAF domain-containing protein -
NG894_RS27075 (NG894_27060) 112007..112927 - 921 WP_004213934.1 DUF1471 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid blaTEM-1B / aac(3)-IId / blaSHV-12 / qnrB4 / blaDHA-1 / sul1 / armA / msr(E) / mph(E) / mph(A) rmpA / iutA / iucD / iucC / iucB / iucA 1..302470 302470
- flank IS/Tn - - 109864..110844 980


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(6-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 148 a.a.        Molecular weight: 16006.74 Da        Isoelectric Point: 9.3642

>T249071 WP_004213072.1 NZ_CP099523:107574-108017 [Klebsiella pneumoniae]
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFERVPGLVLEDWVKKAALCRVIS

Download         Length: 444 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8677.73 Da        Isoelectric Point: 4.4563

>AT249071 WP_004213073.1 NZ_CP099523:107347-107577 [Klebsiella pneumoniae]
MRTVSIFKNGNNRAIRLPRDLDFDGVSELEIVREGDSIILRPVRPTWGSFAQLDRAAPDFMAEREDVVSDEGRFEP

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB Q6U619

Antitoxin

Source ID Structure
AlphaFold DB Q6U620

References