Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) /RES-TIGR02293
Location 8686..9596 Replicon plasmid pSZS128-Hv-MDR
Accession NZ_CP099523
Organism Klebsiella pneumoniae strain SZS128

Toxin (Protein)


Gene name - Uniprot ID A0A663AYG0
Locus tag NG894_RS26495 Protein ID WP_004026354.1
Coordinates 9126..9596 (+) Length 157 a.a.

Antitoxin (Protein)


Gene name - Uniprot ID A0A2J4RLY9
Locus tag NG894_RS26490 Protein ID WP_004181895.1
Coordinates 8686..9129 (+) Length 148 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NG894_RS26465 (NG894_26450) 3723..3929 + 207 WP_004026437.1 hypothetical protein -
NG894_RS26470 (NG894_26455) 4013..4492 + 480 WP_004181843.1 hypothetical protein -
NG894_RS26475 (NG894_26460) 5319..6806 + 1488 WP_004178082.1 group II intron reverse transcriptase/maturase -
NG894_RS26480 (NG894_26465) 6892..7314 + 423 WP_004181893.1 translesion error-prone DNA polymerase V autoproteolytic subunit -
NG894_RS26485 (NG894_26470) 7314..8585 + 1272 WP_152900732.1 translesion error-prone DNA polymerase V subunit UmuC -
NG894_RS26490 (NG894_26475) 8686..9129 + 444 WP_004181895.1 DUF2384 domain-containing protein Antitoxin
NG894_RS26495 (NG894_26480) 9126..9596 + 471 WP_004026354.1 RES family NAD+ phosphorylase Toxin
NG894_RS26500 (NG894_26485) 9706..9966 - 261 WP_004026352.1 hypothetical protein -
NG894_RS26505 (NG894_26490) 10537..11718 - 1182 WP_078207741.1 IS481 family transposase -
NG894_RS26510 (NG894_26495) 11819..12523 - 705 WP_001067855.1 IS6-like element IS26 family transposase -
NG894_RS26515 (NG894_26500) 12588..13838 - 1251 Protein_12 transposase -
NG894_RS26520 (NG894_26505) 13913..14581 - 669 WP_001300294.1 EAL domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid blaTEM-1B / aac(3)-IId / blaSHV-12 / qnrB4 / blaDHA-1 / sul1 / armA / msr(E) / mph(E) / mph(A) rmpA / iutA / iucD / iucC / iucB / iucA 1..302470 302470


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

RES domain

(3-148)

Antitoxin

Antitoxin Xre-like, helix-turn-helix domain

(30-89)


Sequences

Toxin        


Download         Length: 157 a.a.        Molecular weight: 17515.79 Da        Isoelectric Point: 4.6155

>T249070 WP_004026354.1 NZ_CP099523:9126-9596 [Klebsiella pneumoniae]
VILYRLTKTKYLSTAWTGYGAKEAGGRWNSVGVSMVYVSETASLTMLETLVHLHAAQIMDSFTLLSIDVPDELIQSANMD
ELPGNWADEDAPQELADYGDAWSFTRSSVALRVPSALSPVEFNYLLNPEHPEFYGIVQKAQQIPFRFDSRLKPDRK

Download         Length: 471 bp

Antitoxin


Download         Length: 148 a.a.        Molecular weight: 16536.87 Da        Isoelectric Point: 10.3013

>AT249070 WP_004181895.1 NZ_CP099523:8686-9129 [Klebsiella pneumoniae]
MKTFSLSSTPARPQRLWQVAGLNNADGVALLGQINEGLDGKVVNRITDWARITQNDLRKMSGIPSTTFSRSVKARFNPEQ
SERLVRIIRVIDRAVDLFEGDREAAQKWLNEPNRALSWKVPADLMASETGAYEVIKLITRLEHGVYS

Download         Length: 444 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A663AYG0

Antitoxin

Source ID Structure
AlphaFold DB A0A2J4RLY9

References