Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
Location | 5291776..5292401 | Replicon | chromosome |
Accession | NZ_CP099522 | ||
Organism | Klebsiella pneumoniae strain SZS128 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | R4Y4A3 |
Locus tag | NG894_RS26090 | Protein ID | WP_002882817.1 |
Coordinates | 5291776..5292159 (-) | Length | 128 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | J2DFR0 |
Locus tag | NG894_RS26095 | Protein ID | WP_004150355.1 |
Coordinates | 5292159..5292401 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NG894_RS26075 (NG894_26060) | 5289142..5290044 | + | 903 | WP_002882822.1 | formate dehydrogenase subunit beta | - |
NG894_RS26080 (NG894_26065) | 5290041..5290676 | + | 636 | WP_002882818.1 | formate dehydrogenase cytochrome b556 subunit | - |
NG894_RS26085 (NG894_26070) | 5290673..5291602 | + | 930 | WP_004150358.1 | formate dehydrogenase accessory protein FdhE | - |
NG894_RS26090 (NG894_26075) | 5291776..5292159 | - | 384 | WP_002882817.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
NG894_RS26095 (NG894_26080) | 5292159..5292401 | - | 243 | WP_004150355.1 | CopG family transcriptional regulator | Antitoxin |
NG894_RS26100 (NG894_26085) | 5292606..5293523 | + | 918 | WP_002882812.1 | alpha/beta hydrolase | - |
NG894_RS26105 (NG894_26090) | 5293537..5294478 | - | 942 | WP_004178031.1 | fatty acid biosynthesis protein FabY | - |
NG894_RS26110 (NG894_26095) | 5294523..5294960 | - | 438 | WP_002882809.1 | D-aminoacyl-tRNA deacylase | - |
NG894_RS26115 (NG894_26100) | 5294957..5295817 | - | 861 | WP_002882807.1 | virulence factor BrkB family protein | - |
NG894_RS26120 (NG894_26105) | 5295811..5296410 | - | 600 | WP_004151865.1 | glucose-1-phosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 128 a.a. Molecular weight: 14377.62 Da Isoelectric Point: 7.3178
>T249069 WP_002882817.1 NZ_CP099522:c5292159-5291776 [Klebsiella pneumoniae]
MTSGSALFDTNILIDLFSGRREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKDFAGIPGVVTPYEIHPE
MTSGSALFDTNILIDLFSGRREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKDFAGIPGVVTPYEIHPE
Download Length: 384 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GPK8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GGU9 |