Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 4106734..4107353 | Replicon | chromosome |
Accession | NZ_CP099522 | ||
Organism | Klebsiella pneumoniae strain SZS128 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | R8WYV2 |
Locus tag | NG894_RS20400 | Protein ID | WP_002892050.1 |
Coordinates | 4107135..4107353 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | J2DPF6 |
Locus tag | NG894_RS20395 | Protein ID | WP_002892066.1 |
Coordinates | 4106734..4107108 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NG894_RS20385 (NG894_20375) | 4101886..4103079 | + | 1194 | WP_002892072.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
NG894_RS20390 (NG894_20380) | 4103102..4106248 | + | 3147 | WP_020326861.1 | multidrug efflux RND transporter permease subunit AcrB | - |
NG894_RS20395 (NG894_20385) | 4106734..4107108 | + | 375 | WP_002892066.1 | Hha toxicity modulator TomB | Antitoxin |
NG894_RS20400 (NG894_20390) | 4107135..4107353 | + | 219 | WP_002892050.1 | HHA domain-containing protein | Toxin |
NG894_RS20405 (NG894_20395) | 4107512..4108078 | + | 567 | WP_002892030.1 | maltose O-acetyltransferase | - |
NG894_RS20410 (NG894_20400) | 4108050..4108190 | - | 141 | WP_004147370.1 | hypothetical protein | - |
NG894_RS20415 (NG894_20405) | 4108211..4108681 | + | 471 | WP_002892026.1 | YlaC family protein | - |
NG894_RS20420 (NG894_20410) | 4108656..4110107 | - | 1452 | WP_002892023.1 | PLP-dependent aminotransferase family protein | - |
NG894_RS20425 (NG894_20415) | 4110208..4110906 | + | 699 | WP_002892021.1 | GNAT family protein | - |
NG894_RS20430 (NG894_20420) | 4110903..4111043 | - | 141 | WP_002892018.1 | type B 50S ribosomal protein L36 | - |
NG894_RS20435 (NG894_20425) | 4111043..4111306 | - | 264 | WP_002892011.1 | type B 50S ribosomal protein L31 | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T249065 WP_002892050.1 NZ_CP099522:4107135-4107353 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14368.06 Da Isoelectric Point: 4.8989
>AT249065 WP_002892066.1 NZ_CP099522:4106734-4107108 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2P8K6F2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GJ93 |