Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 706064..706839 | Replicon | chromosome |
Accession | NZ_CP099522 | ||
Organism | Klebsiella pneumoniae strain SZS128 |
Toxin (Protein)
Gene name | TacT2 | Uniprot ID | A0A1Q4Q548 |
Locus tag | NG894_RS03540 | Protein ID | WP_004150910.1 |
Coordinates | 706354..706839 (+) | Length | 162 a.a. |
Antitoxin (Protein)
Gene name | TacA2 | Uniprot ID | W8UEW1 |
Locus tag | NG894_RS03535 | Protein ID | WP_004150912.1 |
Coordinates | 706064..706357 (+) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NG894_RS03515 (NG894_03515) | 701195..702106 | + | 912 | WP_004188550.1 | LysR family transcriptional regulator | - |
NG894_RS03520 (NG894_03520) | 702107..703255 | - | 1149 | WP_004150915.1 | PLP-dependent aspartate aminotransferase family protein | - |
NG894_RS03525 (NG894_03525) | 703266..704642 | - | 1377 | WP_004217775.1 | cystathionine beta-synthase | - |
NG894_RS03535 (NG894_03535) | 706064..706357 | + | 294 | WP_004150912.1 | DUF1778 domain-containing protein | Antitoxin |
NG894_RS03540 (NG894_03540) | 706354..706839 | + | 486 | WP_004150910.1 | GNAT family N-acetyltransferase | Toxin |
NG894_RS03545 (NG894_03545) | 707543..708136 | + | 594 | WP_133400560.1 | hypothetical protein | - |
NG894_RS03550 (NG894_03550) | 708233..708449 | + | 217 | Protein_697 | transposase | - |
NG894_RS03555 (NG894_03555) | 709055..709927 | + | 873 | WP_004188557.1 | ParA family protein | - |
NG894_RS03560 (NG894_03560) | 709927..710310 | + | 384 | WP_004150906.1 | hypothetical protein | - |
NG894_RS03565 (NG894_03565) | 710303..711670 | + | 1368 | WP_004150905.1 | SPI-7-type island replicative DNA helicase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | IScluster/Tn | - | - | 705021..708385 | 3364 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 162 a.a. Molecular weight: 17551.59 Da Isoelectric Point: 8.8818
>T249058 WP_004150910.1 NZ_CP099522:706354-706839 [Klebsiella pneumoniae]
MISAPEPLHAGHILTPFCCGIDSMDHWLKQRAMKNQVTGASRTFVCCDDAKVMAYYSLASSAVTTNTAPGRFRRNMPAPI
PVVVLGRLAVDKSLHGKGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEARDFYLRVGFEPSPMDPMMLMVTLRDLVN
A
MISAPEPLHAGHILTPFCCGIDSMDHWLKQRAMKNQVTGASRTFVCCDDAKVMAYYSLASSAVTTNTAPGRFRRNMPAPI
PVVVLGRLAVDKSLHGKGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEARDFYLRVGFEPSPMDPMMLMVTLRDLVN
A
Download Length: 486 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1Q4Q548 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GVL4 |