Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 4776163..4776820 | Replicon | chromosome |
| Accession | NZ_CP099513 | ||
| Organism | Klebsiella sp. ZYC-1 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | A0A9E1DA00 |
| Locus tag | NDO58_RS22385 | Protein ID | WP_024358614.1 |
| Coordinates | 4776163..4776573 (-) | Length | 137 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | H3N295 |
| Locus tag | NDO58_RS22390 | Protein ID | WP_004124953.1 |
| Coordinates | 4776554..4776820 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NDO58_RS22365 (NDO58_22335) | 4772140..4773873 | - | 1734 | WP_049090244.1 | single-stranded-DNA-specific exonuclease RecJ | - |
| NDO58_RS22370 (NDO58_22340) | 4773879..4774592 | - | 714 | WP_004134425.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| NDO58_RS22375 (NDO58_22345) | 4774615..4775511 | - | 897 | WP_004124942.1 | site-specific tyrosine recombinase XerD | - |
| NDO58_RS22380 (NDO58_22350) | 4775633..4776154 | + | 522 | WP_024358613.1 | flavodoxin FldB | - |
| NDO58_RS22385 (NDO58_22355) | 4776163..4776573 | - | 411 | WP_024358614.1 | protein YgfX | Toxin |
| NDO58_RS22390 (NDO58_22360) | 4776554..4776820 | - | 267 | WP_004124953.1 | FAD assembly factor SdhE | Antitoxin |
| NDO58_RS22395 (NDO58_22365) | 4777065..4778048 | + | 984 | WP_024358615.1 | tRNA-modifying protein YgfZ | - |
| NDO58_RS22400 (NDO58_22370) | 4778175..4778834 | - | 660 | WP_004124978.1 | hemolysin III family protein | - |
| NDO58_RS22405 (NDO58_22375) | 4778997..4779308 | - | 312 | WP_004133599.1 | N(4)-acetylcytidine aminohydrolase | - |
| NDO58_RS22410 (NDO58_22380) | 4779359..4780087 | + | 729 | WP_024358621.1 | MurR/RpiR family transcriptional regulator | - |
| NDO58_RS22415 (NDO58_22385) | 4780209..4781642 | + | 1434 | WP_024358622.1 | 6-phospho-beta-glucosidase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 16135.97 Da Isoelectric Point: 10.9455
>T249055 WP_024358614.1 NZ_CP099513:c4776573-4776163 [Klebsiella sp. ZYC-1]
VVLWQSDLRISWRAQWFSLLMHGVVAALVLLMPWPLSYTPLWLILLSLVVFDCVRSQRRIHARQGEIKLLIDSRLRWQKA
EWEIIGTPWVINSGMLLRLRNTENQRTQHLWVAADSMDAGEWRDLRRLVLQKPTQE
VVLWQSDLRISWRAQWFSLLMHGVVAALVLLMPWPLSYTPLWLILLSLVVFDCVRSQRRIHARQGEIKLLIDSRLRWQKA
EWEIIGTPWVINSGMLLRLRNTENQRTQHLWVAADSMDAGEWRDLRRLVLQKPTQE
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|