Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | ypjF-yeeU/CbtA-CbeA |
Location | 4738744..4739453 | Replicon | chromosome |
Accession | NZ_CP099513 | ||
Organism | Klebsiella sp. ZYC-1 |
Toxin (Protein)
Gene name | ypjF | Uniprot ID | - |
Locus tag | NDO58_RS22160 | Protein ID | WP_029602169.1 |
Coordinates | 4738744..4739067 (-) | Length | 108 a.a. |
Antitoxin (Protein)
Gene name | yeeU | Uniprot ID | - |
Locus tag | NDO58_RS22165 | Protein ID | WP_098067228.1 |
Coordinates | 4739103..4739453 (-) | Length | 117 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NDO58_RS22135 (NDO58_22105) | 4734204..4735853 | + | 1650 | WP_102650118.1 | OFA family MFS transporter | - |
NDO58_RS22140 (NDO58_22110) | 4735895..4736053 | - | 159 | WP_004134456.1 | AAA family ATPase | - |
NDO58_RS22145 (NDO58_22115) | 4736246..4736671 | - | 426 | WP_024358596.1 | glutaredoxin-dependent arsenate reductase | - |
NDO58_RS22150 (NDO58_22120) | 4736681..4737973 | - | 1293 | WP_064343183.1 | arsenic transporter | - |
NDO58_RS22155 (NDO58_22125) | 4738026..4738376 | - | 351 | WP_004134443.1 | transcriptional regulator | - |
NDO58_RS22160 (NDO58_22130) | 4738744..4739067 | - | 324 | WP_029602169.1 | TA system toxin CbtA family protein | Toxin |
NDO58_RS22165 (NDO58_22135) | 4739103..4739453 | - | 351 | WP_098067228.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
NDO58_RS22170 (NDO58_22140) | 4739474..4739695 | - | 222 | WP_098067229.1 | DUF987 domain-containing protein | - |
NDO58_RS22175 (NDO58_22145) | 4739710..4740183 | - | 474 | WP_209573830.1 | DNA repair protein RadC | - |
NDO58_RS22180 (NDO58_22150) | 4740254..4740463 | - | 210 | Protein_4334 | DUF932 domain-containing protein | - |
NDO58_RS22185 (NDO58_22155) | 4740678..4741571 | - | 894 | WP_286454008.1 | 50S ribosome-binding GTPase | - |
NDO58_RS22190 (NDO58_22160) | 4741669..4742820 | + | 1152 | WP_141522397.1 | hypothetical protein | - |
NDO58_RS22195 (NDO58_22165) | 4743221..4743460 | + | 240 | WP_004129359.1 | AlpA family phage regulatory protein | - |
NDO58_RS22200 (NDO58_22170) | 4743739..4744317 | + | 579 | WP_098067235.1 | inovirus-type Gp2 protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 108 a.a. Molecular weight: 12271.15 Da Isoelectric Point: 6.4617
>T249054 WP_029602169.1 NZ_CP099513:c4739067-4738744 [Klebsiella sp. ZYC-1]
MNTLPAINQRAVQPYPSPVVVWQMLLARLLEQHYGLTLNDTPFSDEAVIKGHIEAGITLVDAVNFLVEKYELVRVDQRGF
SWQEQAPYLTIVDIMRARRYLGITNRS
MNTLPAINQRAVQPYPSPVVVWQMLLARLLEQHYGLTLNDTPFSDEAVIKGHIEAGITLVDAVNFLVEKYELVRVDQRGF
SWQEQAPYLTIVDIMRARRYLGITNRS
Download Length: 324 bp
Antitoxin
Download Length: 117 a.a. Molecular weight: 12916.67 Da Isoelectric Point: 5.5068
>AT249054 WP_098067228.1 NZ_CP099513:c4739453-4739103 [Klebsiella sp. ZYC-1]
MSNKTLTANDDTAEPWWGLSRNVIPCFGARMVQEGNRLHYLADRASITGQFNEADLLHLDQAFPVLLKQVELMLTSGELN
PRHQHCVTLYAKGLTCEADTLGSCGYVYIAIYPTQS
MSNKTLTANDDTAEPWWGLSRNVIPCFGARMVQEGNRLHYLADRASITGQFNEADLLHLDQAFPVLLKQVELMLTSGELN
PRHQHCVTLYAKGLTCEADTLGSCGYVYIAIYPTQS
Download Length: 351 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|