Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 1313112..1313731 Replicon chromosome
Accession NZ_CP099513
Organism Klebsiella sp. ZYC-1

Toxin (Protein)


Gene name Hha Uniprot ID H3N9D8
Locus tag NDO58_RS06105 Protein ID WP_004099646.1
Coordinates 1313112..1313330 (-) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID H3N7X7
Locus tag NDO58_RS06110 Protein ID WP_004129911.1
Coordinates 1313357..1313731 (-) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NDO58_RS06070 (NDO58_06070) 1309159..1309422 + 264 WP_004129897.1 type B 50S ribosomal protein L31 -
NDO58_RS06075 (NDO58_06075) 1309422..1309562 + 141 WP_003859006.1 type B 50S ribosomal protein L36 -
NDO58_RS06080 (NDO58_06080) 1309559..1310257 - 699 WP_004136044.1 GNAT family protein -
NDO58_RS06085 (NDO58_06085) 1310358..1311812 + 1455 WP_154932232.1 PLP-dependent aminotransferase family protein -
NDO58_RS06090 (NDO58_06090) 1311787..1312257 - 471 WP_004136048.1 YlaC family protein -
NDO58_RS06095 (NDO58_06095) 1312278..1312412 + 135 WP_223226911.1 hypothetical protein -
NDO58_RS06100 (NDO58_06100) 1312384..1312950 - 567 WP_286454270.1 maltose O-acetyltransferase -
NDO58_RS06105 (NDO58_06105) 1313112..1313330 - 219 WP_004099646.1 HHA domain-containing protein Toxin
NDO58_RS06110 (NDO58_06110) 1313357..1313731 - 375 WP_004129911.1 Hha toxicity modulator TomB Antitoxin
NDO58_RS06115 (NDO58_06115) 1314200..1317346 - 3147 WP_004848339.1 multidrug efflux RND transporter permease subunit AcrB -
NDO58_RS06120 (NDO58_06120) 1317369..1318562 - 1194 WP_004136054.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8640.05 Da        Isoelectric Point: 8.9008

>T249048 WP_004099646.1 NZ_CP099513:c1313330-1313112 [Klebsiella sp. ZYC-1]
MSDKTLTKIDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPPSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14350.09 Da        Isoelectric Point: 4.8989

>AT249048 WP_004129911.1 NZ_CP099513:c1313731-1313357 [Klebsiella sp. ZYC-1]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIAAFALNYKIKYAEDNKLITQIDEYL
DDTFVLFSNYGINSADLQKWRKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3H713

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3HD25

References