Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
| Location | 26853..27463 | Replicon | chromosome |
| Accession | NZ_CP099513 | ||
| Organism | Klebsiella sp. ZYC-1 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | NDO58_RS00125 | Protein ID | WP_098363641.1 |
| Coordinates | 27089..27463 (+) | Length | 125 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | NDO58_RS00120 | Protein ID | WP_077253475.1 |
| Coordinates | 26853..27092 (+) | Length | 80 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NDO58_RS00095 (NDO58_00095) | 22839..23438 | + | 600 | WP_024360709.1 | glucose-1-phosphatase | - |
| NDO58_RS00100 (NDO58_00100) | 23432..24292 | + | 861 | WP_286454087.1 | virulence factor BrkB family protein | - |
| NDO58_RS00105 (NDO58_00105) | 24289..24726 | + | 438 | WP_004132870.1 | D-aminoacyl-tRNA deacylase | - |
| NDO58_RS00110 (NDO58_00110) | 24771..25712 | + | 942 | WP_004127112.1 | fatty acid biosynthesis protein FabY | - |
| NDO58_RS00115 (NDO58_00115) | 25730..26647 | - | 918 | WP_024360706.1 | alpha/beta hydrolase | - |
| NDO58_RS00120 (NDO58_00120) | 26853..27092 | + | 240 | WP_077253475.1 | CopG family transcriptional regulator | Antitoxin |
| NDO58_RS00125 (NDO58_00125) | 27089..27463 | + | 375 | WP_098363641.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| NDO58_RS00130 (NDO58_00130) | 27501..28430 | - | 930 | WP_004132861.1 | formate dehydrogenase accessory protein FdhE | - |
| NDO58_RS00135 (NDO58_00135) | 28774..29409 | - | 636 | WP_004132860.1 | formate dehydrogenase cytochrome b556 subunit | - |
| NDO58_RS00140 (NDO58_00140) | 29406..30308 | - | 903 | WP_004122548.1 | formate dehydrogenase subunit beta | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 14081.36 Da Isoelectric Point: 8.4571
>T249046 WP_098363641.1 NZ_CP099513:27089-27463 [Klebsiella sp. ZYC-1]
MIKGPALFDTNILIDLFSGRVEAKQVLEAYPPQNAISLITWTEVMVGAKKYHQEHRTRIALSAFNIIDISQDIAERSVNL
RKEYGMKLPDAIILATAQIHRYELVTRNTKDFFGIPGVITPYHL
MIKGPALFDTNILIDLFSGRVEAKQVLEAYPPQNAISLITWTEVMVGAKKYHQEHRTRIALSAFNIIDISQDIAERSVNL
RKEYGMKLPDAIILATAQIHRYELVTRNTKDFFGIPGVITPYHL
Download Length: 375 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|