Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 29790..30433 Replicon plasmid pP13-67
Accession NZ_CP099512
Organism Lelliottia amnigena strain P13

Toxin (Protein)


Gene name vagD Uniprot ID Q84A06
Locus tag NFJ01_RS21995 Protein ID WP_000754566.1
Coordinates 30017..30433 (+) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID Q84A07
Locus tag NFJ01_RS21990 Protein ID WP_001261276.1
Coordinates 29790..30020 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NFJ01_RS21955 (NFJ01_21955) 24980..25249 + 270 WP_000339857.1 hypothetical protein -
NFJ01_RS21960 (NFJ01_21960) 25426..26292 - 867 WP_004118283.1 replication initiation protein -
NFJ01_RS21965 (NFJ01_21965) 26822..26926 + 105 WP_032409716.1 hypothetical protein -
NFJ01_RS21970 (NFJ01_21970) 27055..27312 + 258 WP_000764642.1 hypothetical protein -
NFJ01_RS21975 (NFJ01_21975) 27370..28146 - 777 WP_020956881.1 tyrosine-type recombinase/integrase -
NFJ01_RS21980 (NFJ01_21980) 28158..28844 - 687 WP_020956882.1 hypothetical protein -
NFJ01_RS21985 (NFJ01_21985) 28908..29201 - 294 WP_020956883.1 hypothetical protein -
NFJ01_RS21990 (NFJ01_21990) 29790..30020 + 231 WP_001261276.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
NFJ01_RS21995 (NFJ01_21995) 30017..30433 + 417 WP_000754566.1 type II toxin-antitoxin system VapC family toxin Toxin
NFJ01_RS22000 (NFJ01_22000) 30514..31218 + 705 WP_001067855.1 IS6-like element IS26 family transposase -
NFJ01_RS22005 (NFJ01_22005) 31247..32452 - 1206 Protein_35 chromate efflux transporter -
NFJ01_RS22010 (NFJ01_22010) 32677..33381 + 705 WP_001067858.1 IS6-like element IS26 family transposase -
NFJ01_RS22015 (NFJ01_22015) 33435..34904 - 1470 Protein_37 Tn3-like element TnAs3 family transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid tet(A) / floR / qnrS1 / aph(6)-Id / aph(3'')-Ib / sul2 / blaTEM-1A / sul1 / qacE / aadA2 / dfrA12 - 1..66758 66758


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(6-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15006.52 Da        Isoelectric Point: 9.2957

>T249045 WP_000754566.1 NZ_CP099512:30017-30433 [Lelliottia amnigena]
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAVLPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNVREFARVPGLVLEDWVK

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8721.74 Da        Isoelectric Point: 4.3533

>AT249045 WP_001261276.1 NZ_CP099512:29790-30020 [Lelliottia amnigena]
MRTVSIFKNGNNRAIRLPRDLDFDGVSELEIVREGDSIILRPVRPTWGSFAQLDRADPDFMAEREDVVSDEGRFEP

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A387K1G3

Antitoxin

Source ID Structure
AlphaFold DB A0A387K023

References